Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65)

What is VPS65 and what is known about its structure?

VPS65 (Vacuolar Protein Sorting 65) is a putative uncharacterized protein in Saccharomyces cerevisiae consisting of 104 amino acids. The amino acid sequence is: MRHCIIFIVCISIVEIRTVHIEFIKEIVVIFRIVDHFSPFMLPCLLSHCKDGDTIIFVCQSVMKVRNISLWNKLVLVRHCVLLCAFLLSFFNVLHSIISICRIF . While the protein has been identified in the yeast genome, its three-dimensional structure remains unresolved. Preliminary sequence analysis suggests it may contain transmembrane regions, which is consistent with potential roles in organelle membranes or protein trafficking.

Why is VPS65 classified as "uncharacterized" and what approaches are used to study such proteins?

VPS65 is classified as "uncharacterized" because its biological function has not been experimentally verified. This classification is common in genomics where open reading frames (ORFs) are identified but their functions remain unknown. Researchers typically approach uncharacterized proteins through multiple complementary methods:

• Bioinformatic analysis (sequence homology, domain prediction)

• Localization studies using fluorescent protein fusions

• Deletion/knockout phenotype assessment

• Protein-protein interaction studies

• Transcriptomic analysis under various conditions

S. cerevisiae provides an excellent model system for such studies due to its well-characterized genome and the availability of comprehensive deletion libraries .

What expression systems are commonly used for recombinant VPS65 production?

For recombinant expression of VPS65, E. coli systems are commonly employed. The protein can be produced with an N-terminal His-tag to facilitate purification . The typical workflow includes:

When working with VPS65, researchers should be aware that membrane-associated proteins may require specialized solubilization conditions. The recombinant protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1 mg/mL before use .

What techniques are most effective for inferring the function of VPS65?

Inferring the function of uncharacterized proteins like VPS65 requires an integrated approach:

• Comparative genomics: Comparing VPS65 across 704 organisms can identify conserved pathways and processes, suggesting functional relevance .

• Expression pattern analysis: Examining when VPS65 is upregulated can provide functional clues. For example, if VPS65 is upregulated during the postdiauxic shift phase when mitochondria are being developed, this suggests mitochondrial involvement .

• Protein-protein interaction studies: Techniques such as yeast two-hybrid, co-immunoprecipitation, or proximity labeling (BioID) can identify interaction partners of VPS65, providing functional context.

• Phenotypic analysis of deletion mutants: Systematic characterization of ΔvpS65 strains under various conditions can reveal functional roles.

• Genetic interaction mapping: Synthetic genetic array (SGA) analysis can identify genes that interact with VPS65, placing it in functional networks.

The effectiveness of these approaches depends on experimental design quality and the biological context in which VPS65 operates.

How can researchers investigate the potential role of VPS65 in protein trafficking?

Given that VPS65 belongs to the VPS family of proteins, which are typically involved in vacuolar protein sorting, researchers should consider the following methodological approach:

• Vacuolar protein trafficking assays: Monitor the transport of model cargo proteins (e.g., carboxypeptidase Y) in ΔvpS65 strains.

• GFP-fusion trafficking studies: Create VPS65-GFP fusions and track their movement through the endosomal system using time-lapse microscopy.

• Binding site identification: Techniques similar to those used to identify VpsR and VpsT binding sites can be applied to understand regulatory mechanisms . This includes:

  • Chromatin immunoprecipitation (ChIP) to identify DNA binding sites

  • Electrophoretic mobility shift assay (EMSA) to confirm direct binding

  • Mutagenesis of predicted binding motifs to validate their functional significance

• Interactome analysis: Identify proteins that physically interact with VPS65 using affinity purification coupled with mass spectrometry (AP-MS).

What strategies should be employed to study VPS65 if it's confirmed to be mitochondrially localized?

If VPS65 is confirmed to be one of the uncharacterized proteins potentially localized to mitochondria (UPMs), researchers should employ a systematic approach:

• Respiratory competence testing: Assess growth on non-fermentable carbon sources in ΔvpS65 strains.

• Mitochondrial morphology analysis: Examine mitochondrial network structure using fluorescence microscopy in wild-type vs. ΔvpS65 strains.

• Mitochondrial proteome analysis: Perform quantitative proteomics to identify changes in mitochondrial protein composition in ΔvpS65 strains.

• Respiratory chain complex assembly: Assess the integrity of respiratory chain complexes using blue native PAGE.

• Evolutionary analysis: Since many mitochondrially localized proteins without classical targeting sequences are "emerging genes" specific to S. cerevisiae , researchers should examine the evolutionary context of VPS65 to understand its species-specific roles.

How should researchers design experiments to address potential functional redundancy of VPS65?

Functional redundancy is common in biological systems and may mask phenotypes in single-gene deletion studies. A comprehensive experimental design should include:

• Multiple gene deletions: Create double or triple mutants with genes predicted to have overlapping functions.

• Overexpression studies: Assess the effects of VPS65 overexpression on cellular processes and protein localization.

• Stress conditions: Test ΔvpS65 strains under various stress conditions that might reveal phenotypes not apparent under optimal growth conditions.

• Conditional alleles: Generate temperature-sensitive or auxin-inducible degron versions of VPS65 for temporal control of protein function.

What bioinformatic approaches are most valuable for understanding VPS65?

Bioinformatic analysis forms a critical component of uncharacterized protein research. For VPS65, researchers should consider:

• Structural prediction: Use tools like AlphaFold2 to predict the 3D structure of VPS65, which can provide insights into function.

• Domain and motif analysis: Identify functional domains and motifs that might suggest molecular function.

• Evolutionary analysis: Examine the conservation of VPS65 across fungal species and beyond, as emerging genes often exist only in S. cerevisiae .

• Co-expression network analysis: Identify genes with similar expression patterns to VPS65 across various conditions.

• Functional prediction based on proteome comparison: Apply methods similar to those described by Karathia et al. (2011) to predict functions based on proteome-wide comparisons .

How can research on VPS65 in S. cerevisiae inform studies in higher organisms?

S. cerevisiae serves as an excellent model organism for studying fundamental cellular processes. Research on VPS65 can inform studies in higher organisms through:

• Identification of functional homologs: Bioinformatic analyses can identify potential functional homologs in other species, including humans .

• Conservation of fundamental processes: The vacuolar protein sorting pathway is conserved from yeast to humans, making findings potentially translatable.

• Model for disease-related processes: If VPS65 is involved in protein trafficking or mitochondrial function, findings may be relevant to human diseases related to these processes.

• Methodological framework: The approaches used to characterize VPS65 in yeast provide a framework for studying uncharacterized proteins in more complex organisms.

Karathia et al. (2011) found that S. cerevisiae is likely to be a good model for studying a significant fraction of common biological processes in humans and other animals , suggesting that findings related to VPS65 could have broader implications.

What are the challenges and limitations when working with recombinant VPS65 protein?

Working with recombinant VPS65 presents several challenges that researchers should be aware of:

• Protein stability: The recombinant protein should be stored at -20°C/-80°C and aliquoted to avoid repeated freeze-thaw cycles .

• Proper folding: Expression in E. coli may not recapitulate all post-translational modifications present in yeast.

• Solubility issues: If VPS65 contains transmembrane domains, solubilization may require detergents or specialized buffers.

• Functional assays: Without known biochemical activity, developing functional assays remains challenging.

• Reconstitution conditions: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1 mg/mL .

These challenges should be addressed through careful experimental design and appropriate controls.