Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS69 (VPS69)

Shipped with Ice Packs
In Stock

Description

Functional Insights

VPS69 is associated with vacuolar protein sorting (VPS) pathways, which mediate transport of hydrolases to the vacuole. Key findings include:

  • Role in Vesicle Trafficking: VPS69 belongs to a group of 15 novel proteins (Vps61p–Vps75p) identified in genome-wide screens for vacuolar sorting defects. These proteins influence the carboxypeptidase Y (CPY) pathway, with some also affecting the alkaline phosphatase (ALP) pathway .

  • Actin Cytoskeleton Interaction: Deletion strains of related VPS genes (e.g., vps61Δ, vps67Δ) exhibit disrupted actin cytoskeleton structures, suggesting a potential role in coordinating vesicle transport with cytoskeletal dynamics .

  • Secretion Defects: Mutants lacking VPS69 homologs show impaired α-factor secretion, indicating broader roles in Golgi-to-cell-surface trafficking .

Research Findings from Genomic Screens

A genome-wide screen of 4,653 S. cerevisiae deletion strains identified VPS69 as a nonessential gene critical for vacuolar protein sorting:

  • CPY Secretion Phenotype: Deletion of VPS69 results in moderate secretion of carboxypeptidase Y (CPY), a hallmark of defective vacuolar sorting .

  • Pathway Specificity: VPS69 primarily affects the CPY pathway, unlike proteins like Mon1p or Mon2p, which impact both CPY and ALP pathways .

  • Electron Microscopy Data: Related VPS mutants accumulate 40–50 nm vesicles and aberrant reticular membranes, suggesting roles in vesicle consumption or fusion .

Applications in Research

Recombinant VPS69 is utilized in:

  • Mechanistic Studies: Investigating its interaction with Rab GTPases or actin-related proteins (e.g., Arp5p, Arp6p) .

  • Protein-Protein Interaction Assays: His-tagged VPS69 facilitates pull-down experiments to identify binding partners .

  • ELISA Development: Commercial kits (e.g., Creative BioMart’s product) employ this protein for antibody validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For precise delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
VPS69; YPR087W; Putative uncharacterized protein VPS69
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
VPS69
Target Protein Sequence
MHTYIYIYTVYIQMVAFSPYRIVLPFVAFVDLASFSSFRSYQAFLRPFLRPFRHQTCSSY FALDLDFASAFVVPAASFVESLLAYQAYSAYQACLAYPACLACQAS
Uniprot No.

Target Background

Database Links

STRING: 4932.YPR087W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is VPS69 and how was it identified in the yeast proteome?

VPS69 is a putative uncharacterized protein that belongs to the vacuolar protein sorting (VPS) family in Saccharomyces cerevisiae. It was identified during a comprehensive genome-wide screen of 4653 homozygous diploid gene deletion strains developed by the Saccharomyces Genome Deletion Project. This screening approach examined strains for missorting of carboxypeptidase Y (CPY), a well-established marker for vacuolar protein sorting defects . VPS69 belongs to the novel VPS proteins (VPS61p-VPS75p) identified in this systematic screening process as having a role in the CPY pathway .

How does the CPY secretion assay function as a screening method for identifying VPS gene function?

The CPY secretion assay serves as a primary screening method for identifying vacuolar protein sorting defects. The methodology involves:

  • Colony blotting assay where yeast strains are grown on plates and proteins secreted into the medium are transferred to nitrocellulose membranes

  • Immunoblotting with anti-CPY antibodies to detect secreted CPY

  • Visual evaluation and categorization of the signal intensity as strong, moderate, or weak

What is the general classification system for VPS genes in Saccharomyces cerevisiae?

VPS genes in yeast have been classified into distinct categories based on vacuolar morphology and the phenotypes observed when they are mutated:

ClassVacuolar MorphologyKey CharacteristicsRepresentative Genes
ANormalMild sorting defectsVarious VPS genes
BFragmented vacuolesIntermediate defectsVarious VPS genes
CNo recognizable vacuolesSevere defectsVarious VPS genes
DVariousDefects in vacuole inheritanceVarious VPS genes
EExaggerated prevacuolar compartmentAccumulation of endosome-like structuresVPS2, VPS4, VPS20, VPS22, VPS23, VPS24, VPS25, VPS28, VPS32, VPS36, VPS37, VPS44, VPS46
FVariousVarious defectsOther VPS genes including novel ones

VPS69 was identified among the novel VPS genes, but its specific class assignment requires further phenotypic characterization .

What experimental approaches are most effective for characterizing the function of an uncharacterized protein like VPS69?

Characterizing an uncharacterized VPS protein like VPS69 requires a multi-faceted experimental approach:

  • Phenotypic Analysis: Comprehensive examination of vps69Δ strains for:

    • CPY secretion levels (quantitative immunoblotting)

    • Processing of other vacuolar hydrolases (pulse-chase experiments)

    • Vacuolar morphology (FM4-64 staining, electron microscopy)

    • Growth defects under various conditions (temperature sensitivity, pH, osmotic stress)

  • Protein Localization: Determining the subcellular localization using:

    • GFP/RFP fusion proteins

    • Immunofluorescence microscopy

    • Subcellular fractionation followed by immunoblotting

  • Interaction Partners: Identifying protein-protein interactions via:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation

    • Proximity labeling approaches (BioID)

    • Synthetic genetic array (SGA) analysis

  • Structural Analysis: Determining protein domains and structure through:

    • Bioinformatic prediction tools

    • Recombinant protein expression and purification

    • X-ray crystallography or cryo-EM

The systematic application of these approaches would provide complementary information about VPS69's function within the vacuolar protein sorting pathway .

How can researchers distinguish between direct and indirect effects of VPS69 disruption on the vacuolar protein sorting pathway?

Distinguishing direct from indirect effects of VPS69 disruption requires several strategies:

  • Acute Inactivation:

    • Creation of temperature-sensitive or chemically-inducible degron alleles of VPS69

    • Monitoring immediate versus delayed phenotypic consequences

    • Similar to the approach used with temperature-conditional vps9 alleles, where immediate CPY secretion upon temperature shift indicated direct involvement

  • Pathway Reconstruction:

    • In vitro reconstitution of sorting steps with purified components

    • Sequential addition and omission of purified VPS69 to determine direct biochemical role

  • Epistasis Analysis:

    • Creating double mutants with known components of different sorting steps

    • Analyzing whether phenotypes are additive, suppressive, or unchanged

  • Physical Interaction Studies:

    • Using techniques like in vitro co-immunoprecipitation to identify direct binding partners

    • Similar to approaches used to study interactions between viral proteins and ESCRT components

  • Domain-specific Mutations:

    • Creating targeted mutations in functional domains rather than whole gene deletions

    • Assessing which specific protein functions are compromised

These approaches collectively would help determine whether VPS69 plays a direct mechanistic role in specific vacuolar protein sorting steps or whether its deletion creates secondary effects that indirectly impair sorting .

What is known about potential functional relationships between VPS69 and other novel VPS proteins (VPS61-VPS75)?

The genomic screen that identified VPS69 also identified 14 other novel VPS proteins (VPS61-VPS75). Based on the phenotypic characterization described in the research:

Novel VPS ProteinCPY SecretionCPY ProcessingALP ProcessingProteinase A ProcessingProteinase B Processingα-factor SecretionGrowth at 37°C
VPS69+++++++++++++++++++
VPS71+++++++++++++++
VPS72++++++++++++++++++
VPS73++++++++++++++++++
VPS74+++++++++++++++++++
VPS75++++++++++++++

The pattern of similarities and differences across these phenotypic assays suggests potential functional relationships. For instance, VPS69 shows a pattern most similar to VPS72 and VPS73, suggesting they may function in related steps of the vacuolar protein sorting pathway . Detailed protein interaction studies and epistasis analyses would be necessary to further elucidate these relationships.

What expression systems are optimal for producing recombinant VPS69 protein for biochemical and structural studies?

For producing recombinant VPS69 protein, several expression systems can be employed, each with specific advantages:

  • E. coli Expression System:

    • Suitable for high-yield expression using vectors like pET series

    • Expression can be induced with IPTG at optimal temperatures (typically 30°C for 3-4 hours)

    • Similar to the approach used for S-epitope-tagged Vps23 expression described in the research

    • Optimization may require testing different strains (BL21 Codon Plus recommended for yeast proteins)

    • May require solubility tags (MBP, SUMO, GST) if protein aggregation occurs

  • Yeast Expression System:

    • Homologous expression in S. cerevisiae using vectors with GAL1 promoter

    • Provides appropriate post-translational modifications

    • Can be expressed with native tags to maintain physiological function

    • Lower yield than bacterial systems but higher likelihood of proper folding

  • Cell-free Expression System:

    • Useful for proteins that may be toxic when expressed in living cells

    • Can be performed using TNT T7 coupled reticulocyte lysate system

    • Allows direct incorporation of modified amino acids for structural studies

  • Purification Strategy:

    • Sequential purification using affinity chromatography (via His, S-tag, or other fusion tags)

    • Ion exchange and size exclusion chromatography for highest purity

    • Addition of protease inhibitors throughout purification process

The optimal approach depends on the specific experimental requirements, with E. coli being suitable for initial biochemical characterization and yeast expression more appropriate for functional studies .

What imaging techniques are most effective for characterizing the subcellular localization and dynamics of VPS69?

Characterizing VPS69 subcellular localization requires a comprehensive imaging approach:

  • Fixed-cell Fluorescence Microscopy:

    • Immunofluorescence using antibodies against epitope-tagged VPS69

    • Co-localization with known compartment markers:

      • Vacuolar membrane: Vph1-mCherry

      • Endosomal compartments: Vps8-GFP, Snf7-mCherry

      • Golgi: Sec7-RFP

      • Prevacuolar compartment: Pep12-GFP

  • Live-cell Imaging:

    • N- or C-terminal GFP/mCherry fusions of VPS69 (verification of functionality essential)

    • Time-lapse microscopy to track protein dynamics during:

      • Cell cycle progression

      • Response to osmotic/pH stress

      • Vacuole fusion/fission events

  • Super-resolution Microscopy:

    • Structured illumination microscopy (SIM) for resolving VPS69 within membrane subdomains

    • STORM/PALM for precise nanoscale localization

  • Correlative Light and Electron Microscopy (CLEM):

    • Combining fluorescence with EM to visualize VPS69 in the context of membrane ultrastructure

    • Particularly valuable for characterizing any novel membrane structures similar to those observed in vps mutants

  • Quantitative Analysis:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

    • Single-particle tracking for measuring diffusion kinetics

    • Fluorescence correlation spectroscopy for protein-protein interactions in living cells

These methods should be applied under various genetic backgrounds (wild-type, other vps mutants) to understand the dependencies of VPS69 localization on other sorting machinery components.

What are effective strategies for establishing and validating protein-protein interactions involving VPS69?

Establishing protein-protein interactions involving VPS69 requires multiple complementary approaches:

  • In Vivo Interaction Methods:

    • Yeast two-hybrid screening to identify novel interaction partners

    • Split-ubiquitin assays (particularly useful for membrane-associated proteins)

    • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in living cells

    • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Biochemical Methods:

    • Co-immunoprecipitation using epitope-tagged VPS69

      • Similar to methodologies used for Vps23 interaction studies

      • Solubilization conditions must be optimized for membrane-associated proteins

    • Tandem affinity purification (TAP) to identify stable protein complexes

    • Chemical crosslinking followed by mass spectrometry to capture transient interactions

  • In Vitro Validation:

    • Recombinant protein pull-down assays

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic analysis of interactions

  • Functional Validation:

    • Genetic suppression screens to identify functional interactions

    • Phenotypic analysis of double mutants

    • Reconstitution experiments in which mutant phenotypes are rescued by expression of interacting partners

  • Structural Validation:

    • X-ray crystallography or cryo-EM of co-purified complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

When implementing these approaches, researchers should be mindful of potential artifacts. For instance, the study of VPS proteins has shown that interactions can be sensitive to experimental conditions, as demonstrated in the CIRV p36 and Vps23 interaction studies .

How can understanding VPS69 function contribute to broader knowledge of intracellular trafficking mechanisms?

Understanding VPS69 function can contribute to broader knowledge in several ways:

  • Evolutionary Conservation of Trafficking Mechanisms:

    • Determining whether VPS69 has functional homologs in other organisms

    • Comparing with mammalian trafficking pathways to identify conserved mechanisms

    • The study of VPS genes has already revealed remarkable conservation of cellular machinery, as seen with ESCRT components which function in processes from yeast vacuolar sorting to viral budding in mammals

  • Organelle Biogenesis Understanding:

    • Clarifying steps in vacuole formation and maintenance

    • Potential insights into how membrane identity is established and maintained

    • Similar to how class E VPS genes revealed fundamental insights into multivesicular body formation

  • Cellular Stress Response Mechanisms:

    • Investigating VPS69's potential role in adaptation to environmental stresses

    • Many VPS proteins play roles in stress adaptation through regulation of membrane dynamics

  • Systematic Network Analysis:

    • Integrating VPS69 into the larger network of trafficking machinery

    • Identifying functional redundancies and unique contributions to cellular homeostasis

  • Disease Relevance:

    • Human homologs of yeast VPS genes are implicated in numerous diseases

    • Understanding fundamental mechanisms can provide insights into pathological conditions

The characterization of novel VPS genes like VPS69 continues to expand our understanding of the complex machinery governing intracellular membrane trafficking and organelle biogenesis .

What methodological approaches can be used to determine if VPS69 interacts with cytoskeletal elements?

Several methodological approaches can determine if VPS69 interacts with cytoskeletal elements, which is relevant given that some VPS proteins have shown relationships with the actin cytoskeleton :

  • Co-localization Analysis:

    • Fluorescence microscopy of tagged VPS69 with actin (LifeAct-RFP) or microtubule markers

    • Super-resolution imaging to detect precise spatial relationships

    • Analysis during various cellular processes (budding, endocytosis, vacuole inheritance)

  • Biochemical Association Studies:

    • Co-sedimentation assays with purified cytoskeletal components

    • Actin co-sedimentation to test for direct binding to F-actin

    • Microtubule co-sedimentation with polymerized tubulin

  • Genetic Interaction Studies:

    • Synthetic genetic arrays crossing vps69Δ with mutations in cytoskeletal genes

    • Examination of double mutant phenotypes for enhancement or suppression

    • Similar approaches revealed that mutations in several VPS genes display defects in the actin cytoskeleton

  • Cytoskeleton Disruption Experiments:

    • Treatment with cytoskeletal inhibitors (Latrunculin A for actin, nocodazole for microtubules)

    • Monitoring effects on VPS69 localization and function

    • Analysis of vacuolar protein sorting efficiency under these conditions

  • Live Cell Dynamics:

    • Simultaneous imaging of VPS69 and cytoskeletal elements

    • Correlation of VPS69 movements with cytoskeletal dynamics

    • Analysis of transport events along cytoskeletal tracks

This is particularly relevant since research has shown that some novel VPS proteins, such as Vps61p, Vps64p, and Vps67p, display defects in the actin cytoskeleton at 30°C, suggesting a connection between vacuolar protein sorting and cytoskeletal organization .

What are the critical controls necessary when studying the phenotypes of VPS69 mutant strains?

When studying VPS69 mutant phenotypes, several critical controls must be implemented:

  • Genetic Background Verification:

    • Confirmation of gene deletion by PCR

    • Verification that no secondary mutations have occurred

    • Complementation tests with wild-type VPS69 to confirm the deletion is responsible for observed phenotypes

  • Phenotypic Assay Controls:

    • Inclusion of wild-type strains as negative controls

    • Inclusion of known vps mutants (e.g., vps39) as positive controls

    • Performance of assays under standard conditions (30°C) and stress conditions

    • Quantitative measurement of phenotypes rather than qualitative assessment

  • Expression Level Controls:

    • When reintroducing VPS69, expression levels should be verified

    • Comparison of native promoter versus inducible promoter effects

    • Western blotting to confirm appropriate protein expression

  • Localization Study Controls:

    • Verification that epitope tags do not disrupt protein function

    • Use of multiple tagging strategies (N-terminal vs. C-terminal)

    • Controls for antibody specificity in immunofluorescence studies

  • Functional Rescue Controls:

    • Demonstration that wild-type VPS69 rescues all mutant phenotypes

    • Domain-specific mutants to identify critical functional regions

    • Heterologous expression of potential homologs to test functional conservation

How can researchers overcome challenges in studying membrane-associated proteins like those in the VPS pathway?

Studying membrane-associated VPS proteins presents several challenges that can be addressed through specialized approaches:

  • Protein Solubilization Strategies:

    • Optimization of detergent types and concentrations:

      • Mild detergents (DDM, digitonin) preserve protein-protein interactions

      • Stronger detergents (SDS, Triton X-100) for complete solubilization

    • Detergent screening arrays to identify optimal conditions

    • Amphipols or nanodiscs for maintaining native membrane environment in solution

  • Expression and Purification Challenges:

    • Use of specialized expression systems (e.g., P. pastoris) for higher yields

    • Coexpression with stabilizing binding partners

    • Cell-free expression systems directly into liposomes

    • Fusion with solubility enhancers (MBP, SUMO) that can be cleaved after purification

  • Structural Analysis Approaches:

    • Lipidic cubic phase crystallization for membrane proteins

    • Cryo-EM analysis of membrane-embedded complexes

    • Hydrogen-deuterium exchange mass spectrometry for topology mapping

    • Selective labeling of exposed regions

  • Functional Reconstitution:

    • Liposome reconstitution assays to test function in controlled membrane environments

    • Giant unilamellar vesicles for microscopy-based functional studies

    • Supported lipid bilayers for surface-sensitive techniques

  • Specialized Interaction Studies:

    • Membrane yeast two-hybrid systems

    • In situ proximity labeling (BioID, APEX) to identify neighboring proteins

    • FRET-based approaches for detecting interactions in membranes

These approaches have been successfully applied to study other membrane-associated proteins in the vacuolar protein sorting pathway and can be adapted for investigations of VPS69 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.