Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YA5053W (YAR053W)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant YA5053W is typically expressed in Escherichia coli or S. cerevisiae systems, followed by affinity chromatography (e.g., His-tag purification). Key parameters include:

ParameterDetail
Expression HostE. coli or S. cerevisiae (strain-dependent optimization required).
TagN- or C-terminal tags (determined during production).
Purity≥85% (SDS-PAGE verified).
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C.

Notes: Repeated freeze-thaw cycles degrade protein stability .

Functional Insights

  • Putative Role: YA5053W is annotated as a "putative uncharacterized protein," indicating no confirmed biological function. Homology searches suggest weak similarity to small regulatory peptides in yeast .

  • Genomic Context: Located near genes involved in stress response (YAR052W) and metabolic regulation (YAR054C), but direct interactions are unverified.

Experimental Data

  • Transcriptomic Studies: YAR053W is minimally expressed under standard growth conditions, with no induction observed during glucose deprivation or oxidative stress .

  • Localization: Predicted cytoplasmic localization (YeastGFP database).

Applications and Limitations

  • Research Use: Primarily employed as a negative control in proteomic studies or as a scaffold for protein engineering.

  • Limitations: Lack of functional annotation restricts hypothesis-driven research.

Future Directions

  • Functional Characterization: CRISPR-based knockout studies or interactome analyses (e.g., yeast two-hybrid screens) could elucidate roles in cellular processes.

  • Structural Studies: X-ray crystallography or cryo-EM to resolve 3D architecture.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YAR053W; Putative uncharacterized protein YA5053W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YAR053W
Target Protein Sequence
MYEYLLLTRKNALFSLAINEPSPTFALTIIAIFSSTNVRSSVVRLGCFRVEICCTCHTQY LKLEIMVIISYLKYVNLPCSFIFISNSFALVFKISAEV
Uniprot No.

Target Background

Database Links

STRING: 4932.YAR053W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the YAR053W gene and its encoded protein in Saccharomyces cerevisiae?

YAR053W is a gene in Saccharomyces cerevisiae that encodes a putative uncharacterized protein of 98 amino acids (P39559). The gene is located on chromosome I of the yeast genome and has been identified through genomic sequencing efforts. While categorized as "putative uncharacterized," this designation indicates that the protein's expression has been confirmed, but its functional role remains incompletely characterized through experimental validation. The protein has been cataloged in protein databases such as UniProt, where it is assigned the accession number P39559. Structurally, the full-length protein consists of 98 amino acid residues, with potential post-translational modifications that may influence its functional properties . The limited characterization status presents significant opportunities for researchers to elucidate its biological role through various experimental approaches.

How does YAR053W compare to other uncharacterized yeast proteins?

YAR053W belongs to a substantial group of putative uncharacterized proteins in the Saccharomyces cerevisiae proteome. Comparative genomic analyses reveal that YAR053W is one among several open reading frames identified on chromosome I, including YAR009C, YAR020C, YAR042W, YAR047C, YAR060C, YAR061W, and YAR062W . These proteins represent significant opportunities for functional characterization in yeast biology.

When analyzing YAR053W within this context, researchers should consider:

  • Sequence conservation: YAR053W demonstrates limited sequence homology with characterized proteins, complicating functional predictions based solely on primary structure.

  • Expression patterns: Unlike some uncharacterized proteins that show condition-specific expression, YAR053W appears to be constitutively expressed at low levels across various growth conditions.

  • Evolutionary conservation: Comparative genomics studies suggest that YAR053W may be specific to Saccharomyces species, rather than being widely conserved across fungi.

  • Structural features: Bioinformatic analyses reveal no recognized functional domains in YAR053W, distinguishing it from many other uncharacterized proteins that contain predictable functional motifs.

This comparative context positions YAR053W as a particularly challenging but potentially rewarding target for functional characterization studies in yeast biology.

What expression systems are optimal for recombinant production of YAR053W protein?

Bacterial Expression Systems:

  • E. coli BL21(DE3): The documented success in expressing full-length YAR053W (1-98aa) with N-terminal His-tag demonstrates the feasibility of bacterial expression .

  • Optimization parameters include induction timing (mid-log phase typically yields highest protein levels), IPTG concentration (0.1-1.0 mM), and post-induction temperature (reduced to 18-25°C for improved folding).

  • Consider specialized E. coli strains (Rosetta, Origami) when codon optimization or disulfide bond formation is required.

Yeast Expression Systems:

  • Homologous expression in S. cerevisiae: While not documented in the search results specifically for YAR053W, expressing the protein in its native host may preserve authentic post-translational modifications.

  • S. cerevisiae expression vectors with GAL1 or ADH1 promoters can provide controlled expression levels.

  • Pichia pastoris: For larger-scale production, this methylotrophic yeast offers advantages of high-density culture and methanol-inducible expression.

Mammalian Cell Expression:

  • Reserved for cases requiring specific eukaryotic post-translational modifications not achievable in microbial systems.

The selection between these systems should be guided by research objectives, with bacterial systems favored for structural studies requiring high protein yields, and yeast systems preferred when native folding and post-translational modifications are essential for functional characterization.

What purification protocols yield the highest purity and activity of recombinant YAR053W?

Purification of recombinant YAR053W requires a multi-step approach to achieve high purity while maintaining structural integrity and potential enzymatic activity. Based on the reported N-terminal His-tagged recombinant expression , the following optimized purification protocol is recommended:

Primary Capture:

  • Immobilized Metal Affinity Chromatography (IMAC): Utilize Ni-NTA resin with graduated imidazole elution (50-300 mM) to minimize co-purification of non-specific proteins.

  • Buffer optimization: Include 5-10% glycerol and 1-5 mM β-mercaptoethanol to enhance protein stability during purification.

Secondary Purification:

  • Size Exclusion Chromatography (SEC): Apply the IMAC-purified protein to a Superdex 75 or similar column to separate monomeric YAR053W from aggregates and remaining contaminants.

  • Ion Exchange Chromatography: Consider as an additional step if SEC alone doesn't achieve desired purity, selecting appropriate resin based on the theoretical pI of YAR053W.

Quality Control Metrics:

  • SDS-PAGE should demonstrate >95% purity with a single band at approximately 11-12 kDa (98 amino acids plus His-tag).

  • Western blot confirmation using anti-His antibodies.

  • Mass spectrometry to verify protein identity and integrity.

For researchers investigating potential enzymatic activity, it's crucial to determine protein stability conditions (pH range, temperature sensitivity, cofactor requirements) through thermal shift assays and activity preservation studies. Given the uncharacterized nature of YAR053W, maintaining native conformation should be prioritized through careful optimization of buffer conditions during purification steps.

How can I design experiments to identify potential binding partners or interactors of YAR053W?

Identifying binding partners and interactors of the uncharacterized YAR053W protein requires a multi-faceted approach combining in vivo and in vitro techniques. The following experimental design strategies are recommended:

Yeast Two-Hybrid (Y2H) Screening:

  • Generate YAR053W bait constructs using both N- and C-terminal fusions to account for potential disruption of interaction interfaces.

  • Screen against genomic or cDNA libraries derived from S. cerevisiae under various growth conditions.

  • Validate positive interactions through reciprocal Y2H tests and secondary confirmation methods.

Affinity Purification Mass Spectrometry (AP-MS):

  • Express epitope-tagged YAR053W (His-tag or alternative tags like FLAG or HA) in yeast .

  • Perform affinity purification under native conditions with varying salt concentrations (100-500 mM) to distinguish between stable and transient interactions.

  • Analyze co-purified proteins by mass spectrometry with appropriate controls to filter out common contaminants.

  • Consider SILAC (Stable Isotope Labeling with Amino acids in Cell culture) approaches for quantitative assessment of interaction specificity.

Proximity-Dependent Biotin Identification (BioID):

  • Generate YAR053W-BirA* fusion constructs for expression in yeast.

  • Induce biotinylation of proximal proteins in vivo, followed by streptavidin-based purification.

  • Identify biotinylated proteins through mass spectrometry to map the proximal interactome.

In Vitro Pull-Down Assays:

  • Immobilize purified His-tagged YAR053W on appropriate resin .

  • Incubate with yeast lysates prepared under various physiological conditions.

  • Analyze bound proteins by Western blotting for suspected interactors or mass spectrometry for unbiased discovery.

Validation Approaches:

  • Co-immunoprecipitation of suspected interactors from native yeast extracts.

  • Bimolecular Fluorescence Complementation (BiFC) for in vivo visualization of interaction.

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) for quantitative interaction parameters.

This comprehensive approach accounts for the challenges of studying uncharacterized proteins by employing complementary methods that can detect both stable and transient interactions, providing a foundation for functional characterization of YAR053W.

What computational approaches can predict functional domains and enzymatic activity of YAR053W?

Predicting the functional domains and potential enzymatic activity of YAR053W requires sophisticated computational approaches that extend beyond basic sequence homology searches. A comprehensive computational analysis should integrate multiple prediction methodologies:

Structure Prediction and Analysis:

  • Ab initio structure prediction using AlphaFold2 or RoseTTAFold to generate three-dimensional models, particularly valuable for proteins like YAR053W that lack close homologs with known structures.

  • Structural alignment against protein domains databases (SCOP, CATH) to identify potential structural similarities that aren't apparent at sequence level.

  • Molecular dynamics simulations to identify stable conformations and potential binding pockets.

Sequence-Based Functional Prediction:

  • Hidden Markov Model (HMM) profiles for sensitive detection of distant homologies.

  • Conservation analysis across fungal species to identify evolutionary constraints indicative of functional importance.

  • Analysis of physicochemical properties clustering to predict functional classes.

Integrated Functional Annotation:

  • Gene neighborhood analysis to identify conserved genomic context that might suggest functional associations.

  • Co-expression network analysis to identify genes with correlated expression patterns across various conditions.

  • Protein-protein interaction network positioning to predict functional context.

Enzyme Function Prediction:

  • Active site prediction through analysis of conserved residues and structural motifs.

  • Enzyme classification systems like ECPred or EFICAz that integrate multiple features for enzymatic function prediction.

  • Molecular docking studies with potential substrates based on structural predictions.

Table 1: Computational Prediction Tools for YAR053W Functional Analysis

ApproachRecommended ToolsKey ParametersExpected Outcomes
Structure PredictionAlphaFold2, I-TASSERFull sequence (1-98aa)3D structural models with confidence scores
Domain IdentificationInterProScan, SMARTSequence motif sensitivity thresholdsPotential functional domains or structural motifs
Evolutionary AnalysisConSurf, Rate4SiteMultiple sequence alignment qualityConservation patterns indicative of functional regions
Network-based PredictionSTRING, GeneMANIAEvidence score cutoffs, network depthFunctional associations based on genomic context
Enzyme FunctionEFICAz, EnzymeMinerEC number probability thresholdsPotential enzymatic activities with confidence scores

These computational approaches should be viewed as hypothesis-generating tools that require subsequent experimental validation, particularly for uncharacterized proteins like YAR053W where limited prior knowledge exists to guide functional characterization.

How can gene knockout or CRISPR-based approaches be optimized to study YAR053W function in vivo?

Optimizing gene knockout or CRISPR-based approaches for studying YAR053W function requires careful experimental design that addresses the challenges of manipulating putative uncharacterized genes. The following comprehensive methodology is recommended:

CRISPR-Cas9 Genome Editing Strategy:

  • gRNA Design: Generate multiple gRNAs targeting the YAR053W locus, prioritizing those with high on-target and low off-target scores. For this 98aa protein, target both N-terminal and mid-gene regions to ensure complete functional disruption.

  • Repair Template Construction: Design homology-directed repair (HDR) templates that:

    • Replace YAR053W with selectable markers (URA3, KanMX)

    • Introduce premature stop codons

    • Create in-frame fluorescent protein fusions for localization studies

Traditional Homologous Recombination Approach:

  • PCR-based gene disruption using 40-60bp homology arms flanking a selectable marker.

  • Implementation of the delitto perfetto method for marker-less modifications when clean genetic backgrounds are required.

Validation of Genetic Modifications:

  • PCR verification of correct integration/deletion

  • Sequencing confirmation of the modified locus

  • RT-qPCR to confirm absence of YAR053W transcript

  • Western blotting if antibodies are available or using epitope-tagged versions

Phenotypic Analysis Pipeline:

  • Growth profiling under diverse conditions (carbon sources, stress conditions, temperature ranges)

  • High-throughput fitness profiling using the YAR053W knockout in combination with:

    • Chemical genomics screens (testing growth in presence of various compounds)

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • Metabolic profiling to identify biochemical pathways affected

Advanced Functional Genomics Approaches:

  • Conditional expression systems:

    • Implement tetracycline-regulatable promoters for controlled expression

    • Create temperature-sensitive alleles for temporal control

  • Domain-specific mutagenesis based on computational predictions from section 3.1

  • Complementation studies with orthologs from related species to assess functional conservation

Considerations for Uncharacterized Genes:

  • Account for potential redundancy by creating double or triple knockouts with functionally related genes

  • Design experiments to detect subtle phenotypes that might be missed in standard growth assays

  • Consider environmental conditions relevant to chromosome I genes, where YAR053W is located

This comprehensive approach maximizes the likelihood of detecting functional roles for YAR053W despite its uncharacterized status, providing a systematic framework for in vivo functional analysis.

How should researchers address data inconsistencies when studying uncharacterized proteins like YAR053W?

Source Validation and Experimental Reproducibility:

  • Implement rigorous reagent validation protocols, particularly confirming the identity of recombinant YAR053W through mass spectrometry and sequence verification .

  • Establish minimum reproducibility standards requiring independent biological replicates (n≥3) with clearly defined statistical power calculations.

  • Create standardized protocols for YAR053W expression and purification to minimize preparation-dependent variations.

Systematic Bias Identification:

  • Evaluate the influence of expression systems on protein characteristics by comparing YAR053W expressed in E. coli versus native S. cerevisiae .

  • Assess tag interference effects by comparing N-terminal versus C-terminal tags, and different tag types (His, GST, MBP).

  • Document experimental conditions comprehensively, including buffer compositions, incubation times, and environmental variables.

Data Integration Approaches:

  • Implement weighted evidence synthesis methods that prioritize direct experimental evidence over computational predictions.

  • Apply Bayesian inference models to update confidence in specific hypotheses as new data becomes available.

  • Utilize correlation analysis between multiple experimental outcomes to identify consistent patterns despite methodological variations.

Table 2: Systematic Analysis of Data Inconsistencies for YAR053W Research

Type of InconsistencyAnalytical ApproachResolution Strategy
Expression level variationsQuantitative Western blot with internal standardsStandardize cell density and induction parameters
Functional predictionsMulti-algorithm consensus scoringPrioritize experimentally validated domains
Interaction partner discrepanciesInteraction detection method comparison matrixFocus on interactions confirmed by ≥2 methods
Localization conflictsLive-cell imaging vs. fractionation studiesTime-course analysis to account for dynamic localization
Phenotypic variabilityStrain background genotypingControl for genetic modifiers and epigenetic effects

Reconciliation of Literature Contradictions:

  • Implement systematic literature review protocols with pre-defined inclusion criteria.

  • Contact original authors for clarification of conflicting methodological details.

  • Organize community resources for standardized YAR053W research, similar to approaches used for more characterized yeast proteins.

When specific contradictions arise, researchers should design decisive experiments that can explicitly test competing hypotheses rather than simply adding more potentially ambiguous data. This approach enables progressive resolution of inconsistencies and builds consensus around the functional properties of uncharacterized proteins like YAR053W.

What statistical approaches are most appropriate for analyzing high-throughput data involving YAR053W?

When analyzing high-throughput data involving YAR053W, researchers must implement statistical approaches that address the challenges of studying uncharacterized proteins while maintaining methodological rigor. The following statistical framework is recommended:

Differential Expression Analysis:

  • For transcriptomic data comparing wild-type vs. YAR053W knockout strains:

    • Implement limma or DESeq2 with appropriate multiple testing correction (Benjamini-Hochberg FDR)

    • Apply log2 fold change thresholds (|log2FC| > 1) with significance cutoffs (padj < 0.05)

    • Conduct power analysis to ensure adequate sample size for detecting moderate expression changes

Proteomic Data Analysis:

  • For mass spectrometry-based experiments identifying YAR053W interactors:

    • Employ SAINT (Significance Analysis of INTeractome) algorithm to distinguish true interactions from background

    • Implement CompPASS (Comparative Proteomics Analysis Software Suite) for comparative analysis across conditions

    • Calculate enrichment scores relative to appropriate negative controls (e.g., purifications from strains expressing only the tag)

Network Analysis Approaches:

  • When positioning YAR053W within functional networks:

    • Apply graph theory metrics (betweenness centrality, clustering coefficient) to identify network positions

    • Implement Markov clustering algorithms to define functional modules

    • Calculate semantic similarity scores for Gene Ontology terms to identify functional neighborhoods

Phenotypic Screening Data:

  • For growth assays and chemical genomics screens:

    • Calculate fitness scores using normalized area under growth curve measurements

    • Implement LOWESS normalization to control for plate effects

    • Apply hierarchical clustering with bootstrap confidence assessment to identify condition-specific phenotypic signatures

Table 3: Statistical Methods for High-Throughput YAR053W Studies

Data TypeRecommended Statistical MethodKey ParametersBiological Interpretation
RNA-SeqDESeq2/edgeRpadj < 0.05,log2FC
ProteomicsSAINT/CompPASSFDR < 0.01, enrichment ratio > 5Physical interactome of YAR053W
Genetic Interactionsε-score calculationε-score
MetabolomicsPLS-DA with VIP scoringVIP > 1.5, Q² > 0.5Metabolic pathways affected
ChIP-SeqMACS2 peak callingq-value < 0.01, fold enrichment > 4Potential regulatory roles

Integrative Data Analysis:

  • Implement multivariate statistical methods (PCA, PLS-DA) for integration of multiple data types

  • Apply Bayesian data integration frameworks to combine evidence from diverse experimental approaches

  • Utilize machine learning approaches (random forest, support vector machines) for predictive modeling of YAR053W function

These statistical approaches should be combined with appropriate visualization techniques (e.g., volcano plots, enrichment maps, interaction networks) to communicate complex results effectively. For uncharacterized proteins like YAR053W, statistical rigor is especially important to distinguish genuine biological signals from technical artifacts.

What are the most promising applications of YAR053W in biotechnology and medicine?

The potential applications of YAR053W in biotechnology and medicine remain largely unexplored due to its uncharacterized status, yet several promising research directions emerge from analyzing the available information and analogous proteins:

Therapeutic Applications in Immunology:

  • Recombinant yeast expressing defined proteins has shown promise as immunotherapeutic agents, as demonstrated by the GI-4000 series targeting mutant Ras in cancer therapy . Similar approaches could be developed if YAR053W is found to have immunomodulatory properties or contains epitopes relevant to disease states.

  • The established protocols for expressing recombinant S. cerevisiae proteins in therapeutic contexts provide a translational pathway if YAR053W demonstrates relevant biological activity .

  • Heat-killed yeast vectors encoding target proteins have shown efficacy in stimulating immune responses, suggesting a potential platform if YAR053W proves valuable as an antigen or immunomodulator .

Biotechnological Applications:

  • Enzyme Discovery: If functional characterization reveals enzymatic activity, YAR053W could be developed as a biocatalyst for industrial processes. The established expression systems in E. coli provide a foundation for scalable production .

  • Protein Engineering Platform: The small size (98 amino acids) makes YAR053W an attractive scaffold for protein engineering applications, potentially serving as a minimalist framework for introducing novel functions.

  • Biosensor Development: If YAR053W demonstrates specific binding capabilities to metabolites or environmental compounds, it could be engineered as a biosensing element.

Fundamental Research Value:

  • Model System for Functional Genomics: As an uncharacterized protein, YAR053W represents an opportunity to develop and validate new approaches for functional assignment that could be applied to other orphan genes across species.

  • Evolutionary Biology: Comparative analysis of YAR053W across Saccharomyces species could provide insights into protein evolution and functional adaptation in yeasts.

Considerations for Development:

  • The current recombinant expression systems, particularly the His-tagged version in E. coli, provide a starting point for functional and structural characterization necessary for application development .

  • Safety assessment would be required for therapeutic applications, including evaluation of potential cross-reactivity with human proteins and immunogenicity profiles.

  • Intellectual property landscape appears open for YAR053W applications, as current patents mention the gene but do not appear to claim specific applications .

While these potential applications are speculative without definitive functional characterization, they outline research directions that could be pursued as more information about YAR053W becomes available. The demonstrated success of yeast-derived recombinant proteins in therapeutic contexts provides precedent for potential medical applications if appropriate biological activities are discovered .

How might systems biology approaches advance our understanding of YAR053W's role in cellular networks?

Systems biology approaches offer powerful frameworks for elucidating the functional role of uncharacterized proteins like YAR053W by positioning them within broader cellular networks and biological processes. The following integrated strategies are recommended:

Multi-omics Integration Strategies:

Genome-Scale Modeling Approaches:

  • Constraint-based Metabolic Modeling:

    • Incorporate YAR053W into genome-scale metabolic models of S. cerevisiae

    • Perform flux balance analysis (FBA) simulations with and without YAR053W constraints

    • Identify metabolic pathways sensitive to YAR053W presence through flux variability analysis

  • Whole-Cell Modeling Integration:

    • Position YAR053W within multi-scale models that integrate metabolism, gene expression, and protein interaction networks

    • Conduct in silico perturbation experiments to generate testable hypotheses about YAR053W function

    • Implement ensemble modeling approaches to account for uncertainty in parameter estimates

Dynamic Network Analysis:

  • Temporal Network Reconstruction:

    • Generate time-series data following environmental perturbations in wild-type and YAR053W-mutant strains

    • Apply dynamic Bayesian network inference to reconstruct causal relationships

    • Identify temporal motifs that include YAR053W to elucidate its role in cellular response dynamics

  • Condition-Specific Network Rewiring:

    • Profile network structures across diverse environmental conditions (nutrient limitation, stress, growth phases)

    • Implement differential network analysis to identify condition-specific interactions involving YAR053W

    • Calculate network rewiring scores to quantify the plasticity of YAR053W-associated network components

Table 4: Systems Biology Approaches for YAR053W Functional Characterization

ApproachKey TechnologiesExpected OutcomesValidation Methods
Multi-omics IntegrationRNA-Seq, MS proteomics, metabolomicsCo-regulated gene/protein modulesReporter assays for predicted associations
Genetic Interaction MappingSGA, CRISPR screeningFunctional pathway assignmentTargeted double-knockout phenotyping
Dynamic Response ProfilingTime-series transcriptomicsTemporal role in stress responseReal-time fluorescent reporters
Protein-Protein InteractionAP-MS, BioID, Y2HPhysical interaction neighborhoodCo-immunoprecipitation validation
Metabolic Modeling13C metabolic flux analysisPredicted metabolic impactMetabolite profiling in knockout strains

By implementing these systems biology approaches, researchers can transition from studying YAR053W in isolation to understanding its position and role within the complex cellular machinery of S. cerevisiae. This integrative perspective is particularly valuable for uncharacterized proteins where direct functional assays may not immediately yield clear insights. The resulting network-based hypotheses can then guide more targeted experimental investigations to precisely define YAR053W function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.