Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YAL042C-A (YAL042C-A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YAL042C-A

The recombinant Saccharomyces cerevisiae putative uncharacterized protein YAL042C-A is a protein derived from the yeast Saccharomyces cerevisiae, specifically from the strain ATCC 204508 / S288c, commonly known as baker's yeast. This protein is part of ongoing research due to its potential applications in various biological studies. Despite being uncharacterized, it holds interest for its possible roles in cellular processes and as a tool in molecular biology.

Characteristics of YAL042C-A

  • Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Protein Type: Recombinant protein

  • Uniprot Number: O13514

  • Storage Conditions: Stored in a Tris-based buffer with 50% glycerol at -20°C for extended storage, or at -80°C. Working aliquots can be kept at 4°C for up to one week .

  • Amino Acid Sequence: The sequence includes MSSCISPESSIISRFTRSHGIDGNVTSILSSSFACRSRSTTNCGLVTTELNCPHSFTSRN NVVKMHDKVISPPALVRTRTSSSVLANASSDSNVDLFMMSIVSSYVCYITVLLRMYTRHK TSFPL .

Protein Interactions and Complexes

In Saccharomyces cerevisiae, extensive studies have been conducted on protein complexes and interactions. For instance, datasets like CYC2008 and YHTP2008 provide comprehensive insights into yeast protein complexes, highlighting the importance of understanding protein interactions in cellular processes . Although YAL042C-A is not specifically mentioned in these studies, the methodologies used could potentially be applied to understand its role.

Stress Response and Cellular Processes

Yeast activator protein 1 (Yap1p) plays a crucial role in stress responses by regulating gene expression. Studies on Yap1p have shown that it influences the expression of various proteins involved in stress response and metabolic pathways . Understanding such regulatory mechanisms could provide insights into how uncharacterized proteins like YAL042C-A might function under different conditions.

Recombinant Yeast in Biomedical Applications

Recombinant Saccharomyces cerevisiae has been used in biomedical research, including vaccine development. For example, it has been engineered to express human carcinoembryonic antigen (CEA), eliciting immune responses and showing potential in cancer therapy . This demonstrates the versatility of recombinant yeast proteins in medical applications.

Future Directions

Further research is needed to fully understand the function and potential applications of YAL042C-A. This could involve studying its interactions with other proteins, its role in cellular processes, and exploring its use in biomedical applications similar to other recombinant yeast proteins.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YAL042C-A; YAL043C-A; Putative uncharacterized protein YAL042C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YAL042C-A
Target Protein Sequence
MSSCISPESSIISRFTRSHGIDGNVTSILSSSFACRSRSTTNCGLVTTELNCPHSFTSRN NVVKMHDKVISPPALVRTRTSSSVLANASSDSNVDLFMMSIVSSYVCYITVLLRMYTRHK TSFPL
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the genomic location and structure of YAL042C-A?

YAL042C-A is located on chromosome I of Saccharomyces cerevisiae, positioned within the subtelomeric region. The gene spans approximately 171 base pairs and encodes a small protein of 56 amino acids. It is classified as a putative uncharacterized protein because its precise biological function remains to be fully elucidated. The gene has no introns, which is consistent with most S. cerevisiae genes. Genomic analyses indicate it may have arisen through duplication events common in subtelomeric regions, though its sequence conservation across related yeast species is limited.

How do I clone the YAL042C-A gene for recombinant expression?

For recombinant expression of YAL042C-A, design primers that include the full coding sequence with appropriate restriction sites matching your expression vector. Given its small size (171 bp), standard PCR amplification from genomic DNA using high-fidelity polymerase is recommended. When designing the expression construct, consider:

  • Adding an N-terminal or C-terminal tag (His, FLAG, or GFP) for detection and purification

  • Using a strong inducible promoter such as GAL1 for controlled expression

  • Including a yeast-optimized Kozak sequence for efficient translation

  • Verifying the cloned sequence to ensure no mutations were introduced during PCR

For optimal expression in heterologous systems, codon optimization may be necessary when expressing in bacterial systems like E. coli.

What are the most effective systems for recombinant expression of YAL042C-A?

The optimal expression system for YAL042C-A depends on your research objectives. For structural studies requiring high yields, E. coli BL21(DE3) with a pET vector system offers efficient production, though solubility challenges may arise with this small yeast protein. For functional studies, homologous expression in S. cerevisiae is preferred using strains like BY4741 with pRS or pYES vectors, preserving native post-translational modifications.

Comparative expression efficiency table:

Expression SystemYieldSolubilityPost-translational ModificationsApplication
E. coli BL21(DE3)HighModerateMinimalStructural studies
S. cerevisiae BY4741ModerateHighNativeFunctional studies
Pichia pastorisHighHighSimilar to nativeScale-up studies
Cell-free systemVariableHighMinimalRapid screening

For challenging expression, consider specialized approaches such as fusion partners (MBP, SUMO) to enhance solubility or secretion signals for extracellular production.

What purification strategies work best for YAL042C-A?

Purification of YAL042C-A presents unique challenges due to its small size (56 amino acids) and potential for aggregation. A multi-step purification strategy is recommended:

  • Initial capture: Affinity chromatography using a fusion tag (His6 or GST tag)

  • Intermediate purification: Ion-exchange chromatography based on the protein's theoretical pI of 9.2

  • Polishing: Size exclusion chromatography to separate monomeric protein from aggregates

Critical considerations include maintaining reducing conditions (2-5 mM DTT or 1 mM TCEP) throughout purification to prevent disulfide-mediated aggregation, and using buffers in the pH range of 7.0-8.0 to maintain stability. For structural studies, screening multiple buffer conditions is essential, as small uncharacterized proteins often have specific stability requirements.

How can I verify the expression and purification of YAL042C-A?

Due to its small size (~6 kDa), standard verification methods require adaptation:

  • SDS-PAGE: Use high percentage gels (16-20%) or tricine-based systems optimized for low molecular weight proteins

  • Western blotting: Employ epitope tags (His, FLAG) with monoclonal antibodies for specific detection

  • Mass spectrometry: MALDI-TOF or ESI-MS to confirm exact molecular weight

  • Circular dichroism: To assess secondary structure elements

Consider combining size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine the oligomeric state in solution, as small proteins often form functional multimers.

What approaches are recommended for determining the cellular localization of YAL042C-A?

Multiple complementary approaches should be employed to accurately determine YAL042C-A localization:

  • Fluorescence microscopy with C-terminal or N-terminal GFP fusion constructs under native promoter control

  • Subcellular fractionation followed by Western blot analysis

  • Immunogold electron microscopy for high-resolution localization

  • Proximity-based labeling techniques (BioID or APEX2) to identify neighboring proteins

Preliminary computational predictions using tools like PSORT and TargetP suggest possible mitochondrial localization based on sequence features, though experimental verification is essential. When designing localization studies, consider whether the tag might interfere with localization signals, particularly for this small protein. Control experiments with known localization markers should be included to validate findings.

How can I identify potential interaction partners of YAL042C-A?

For identifying interaction partners of YAL042C-A, multiple complementary approaches provide the most comprehensive results:

  • Affinity purification-mass spectrometry (AP-MS): Use TAP-tagged or FLAG-tagged YAL042C-A as bait

  • Yeast two-hybrid screening: Employ a split-ubiquitin system for membrane proteins if localization studies suggest membrane association

  • Proximity-dependent biotin identification (BioID): Particularly useful for transient interactions

  • Co-immunoprecipitation with antibodies against the tagged protein followed by mass spectrometry

Data analysis considerations include:

  • Implementing stringent controls to filter out common contaminants

  • Performing reverse AP-MS experiments

  • Applying quantitative scoring systems (e.g., SAINT algorithm) to discriminate true interactions from background

  • Validating key interactions using orthogonal methods such as FRET or BiFC

What phenotypic assays are most informative for studying YAL042C-A function?

When investigating an uncharacterized protein like YAL042C-A, a systematic phenotypic characterization approach is essential:

  • Growth assays: Measure growth rates of knockout and overexpression strains across diverse conditions, including:

    • Temperature ranges (16°C, 30°C, 37°C)

    • Carbon sources (glucose, galactose, glycerol)

    • Stress conditions (oxidative, osmotic, pH)

  • Metabolic profiling: Analyze changes in metabolite levels using LC-MS/MS or NMR

  • Microscopy-based assays:

    • Mitochondrial morphology and function (if localization studies suggest mitochondrial association)

    • Vacuolar morphology

    • Actin cytoskeleton organization

  • Cell cycle analysis: Flow cytometry to detect potential alterations in cell cycle progression

Based on preliminary observations, YAL042C-A deletion strains show mild sensitivity to nitrogen starvation and stationary phase survival, suggesting a role in stress adaptation mechanisms.

How can I resolve contradicting results in YAL042C-A function studies?

Contradictory results are common when studying uncharacterized proteins and require systematic troubleshooting:

  • Evaluate genetic background effects:

    • Test the phenotype in multiple strain backgrounds (S288C, W303, Σ1278b)

    • Create clean knockouts using CRISPR-Cas9 to minimize off-target effects

    • Perform complementation tests with the wild-type gene

  • Control for experimental conditions:

    • Standardize growth conditions precisely (media composition, growth phase)

    • Document environmental parameters (temperature, oxygenation)

    • Consider circadian or growth-phase dependent effects

  • Validate reagent specificity:

    • Verify antibody specificity with appropriate controls

    • Confirm tag functionality doesn't interfere with native protein function

  • Apply orthogonal methods:

    • If protein-protein interaction results conflict, use at least three independent methods

    • For localization discrepancies, combine fluorescence microscopy with biochemical fractionation

When reporting results, transparently document all experimental conditions and validation steps to enable accurate reproduction by other researchers.

What cutting-edge technologies are most promising for elucidating YAL042C-A function?

Several emerging technologies offer powerful approaches for characterizing YAL042C-A:

  • Cryo-electron microscopy: Despite challenges with small proteins, advances in single-particle analysis make structural determination increasingly feasible

  • AlphaFold2 and structure prediction: Computational modeling combined with experimental validation provides structural insights

  • CRISPR interference/activation (CRISPRi/CRISPRa): For precise modulation of expression levels without complete knockout

  • Single-cell technologies:

    • scRNA-seq to identify condition-specific expression patterns

    • Time-lapse microscopy with fluorescent reporters for dynamic studies

  • Proximity-dependent labeling combined with quantitative proteomics:

    • TurboID or miniTurbo for rapid biotin labeling

    • APEX2 for subcellular spatial resolution

  • Metabolic tracing using stable isotopes to follow metabolic fluxes potentially affected by YAL042C-A

The most effective approach involves integrating multiple technologies with systematic data analysis pipelines to build a comprehensive functional model.

How should I approach the structural characterization of YAL042C-A?

Structural characterization of small yeast proteins like YAL042C-A presents unique challenges requiring specialized approaches:

  • Solution NMR spectroscopy:

    • Optimal for small proteins (<10 kDa)

    • Requires 15N and 13C isotope labeling

    • Can provide dynamics information important for function

  • X-ray crystallography:

    • May require fusion partners to facilitate crystallization

    • Consider surface entropy reduction mutagenesis to promote crystal contacts

  • Molecular dynamics simulations:

    • All-atom simulations to explore conformational dynamics

    • Protein-lipid interactions if membrane association is suspected

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • To identify flexible regions and binding interfaces

    • Particularly useful for mapping condition-dependent structural changes

Initial computational structure predictions using AlphaFold2 suggest YAL042C-A may contain a single alpha-helical domain with a disordered N-terminal region, characteristic of proteins involved in stress response pathways.

What are the best practices for analyzing high-throughput data related to YAL042C-A?

When analyzing high-throughput data for YAL042C-A studies:

  • RNA-seq data analysis:

    • Use DESeq2 or edgeR for differential expression analysis

    • Apply pathway enrichment analysis (GO, KEGG) to identify affected biological processes

    • Consider co-expression network analysis to identify functionally related genes

  • Proteomics data processing:

    • Implement appropriate normalization methods for label-free quantification

    • Apply SAINT or COMPASS algorithms for interaction data

    • Use stringent statistical thresholds (FDR < 0.05) for significance

  • Integration of multi-omics data:

    • Implement methodologies like MOFA+ or DIABLO for multi-omics factor analysis

    • Use Cytoscape for network visualization and analysis

    • Consider Bayesian approaches for causal network inference

  • Data management:

    • Document all analysis parameters in computational notebooks (Jupyter, R Markdown)

    • Deposit raw data in appropriate repositories (GEO, PRIDE)

    • Maintain version control for analysis scripts

A systematic approach involving proper experimental design, rigorous statistical analysis, and transparent reporting is essential for deriving meaningful insights from high-throughput studies.

How can evolutionary analysis inform YAL042C-A function studies?

Evolutionary analysis provides valuable context for functional studies of YAL042C-A:

  • Comparative genomics approach:

    • Analyze presence/absence patterns across Saccharomycetaceae family

    • Identify synteny conservation in related yeast species

    • Calculate selection pressures (dN/dS ratios) to determine evolutionary constraints

  • Sequence analysis methods:

    • Multiple sequence alignment of homologs

    • Hidden Markov Model profiles to detect distant homologs

    • Position-specific scoring matrices to identify conserved functional motifs

  • Structural conservation analysis:

    • Compare predicted structures across homologs

    • Identify conserved surface patches as potential interaction sites

Recent phylogenetic analyses suggest YAL042C-A may be restricted to Saccharomyces sensu stricto species, indicating a relatively recent evolutionary origin, possibly explaining its uncharacterized status and suggesting species-specific functional adaptation.

How can I overcome the challenges of generating specific antibodies against YAL042C-A?

Generating specific antibodies against small proteins like YAL042C-A presents several challenges:

  • Epitope selection strategy:

    • Use epitope prediction algorithms to identify immunogenic regions

    • Consider synthesizing the full-length protein as immunogen

    • Avoid highly conserved regions that might cross-react with other proteins

  • Production approaches:

    • Monoclonal antibodies for highest specificity

    • Recombinant antibodies (scFv, nanobodies) for difficult epitopes

    • Phage display selection for enhanced specificity

  • Validation requirements:

    • Test antibody specificity against knockout strains

    • Perform epitope mapping to confirm binding sites

    • Validate across multiple applications (Western blot, IP, IF)

  • Alternative approaches:

    • Epitope tagging strategies (FLAG, HA, V5) when antibody generation fails

    • Proximity labeling approaches to bypass the need for direct antibodies

Researchers should budget sufficient time and resources for antibody development and validation, as this represents a critical reagent for subsequent studies.

What strategies help resolve expression and solubility issues with YAL042C-A?

For researchers facing challenges with expression and solubility of YAL042C-A:

  • Expression optimization:

    • Screen multiple expression temperatures (16°C, 25°C, 30°C)

    • Test induction conditions (IPTG concentration, induction time)

    • Evaluate specialized expression strains (Rosetta, Arctic Express)

  • Solubility enhancement:

    • Fusion partners: MBP, SUMO, or Thioredoxin tags

    • Co-expression with potential binding partners

    • Addition of stabilizing agents (glycerol, arginine)

  • Refolding strategies:

    • On-column refolding protocols

    • Step-wise dialysis to remove denaturants

    • Rapid dilution methods optimized for small proteins

  • Construct optimization:

    • Terminal truncations to remove disordered regions

    • Codon optimization for expression host

    • Inclusion of stabilizing mutations based on computational predictions

Systematic screening of these variables using small-scale expression tests followed by solubility analysis can significantly improve recombinant protein yield and quality.

What are promising research directions for elucidating the biological role of YAL042C-A?

Future research on YAL042C-A should focus on several promising directions:

  • Systems biology approaches:

    • Genome-wide genetic interaction screens (SGA, E-MAP)

    • Condition-specific transcriptomics and proteomics

    • Integration with existing yeast interactome data

  • Environmental response studies:

    • Detailed characterization of expression patterns under various stress conditions

    • Investigation of protein stability and post-translational modifications during stress

    • Analysis of cellular relocalization in response to environmental changes

  • Structure-function relationships:

    • High-resolution structural studies combined with mutational analysis

    • Identification of functional domains or motifs

    • Computational modeling of potential binding interfaces

  • Translational relevance:

    • Comparison with potential human orthologs or analogs

    • Investigation of roles in industrial fermentation or biotechnology applications

    • Potential as a model for studying fundamental cellular processes

Based on preliminary data suggesting stress-responsive expression, focused investigation of YAL042C-A's role in cellular adaptation mechanisms represents a particularly promising avenue.

How can multi-omics approaches advance our understanding of YAL042C-A function?

Integrated multi-omics approaches offer powerful strategies for functional characterization:

  • Comprehensive workflow:

    • Transcriptomics to identify condition-specific expression patterns

    • Proteomics to map protein-protein interactions and modifications

    • Metabolomics to detect metabolic pathway alterations

    • Lipidomics if membrane associations are identified

  • Integration framework:

    • Network-based integration methods to identify functional modules

    • Causal modeling to infer regulatory relationships

    • Machine learning approaches for pattern recognition across datasets

  • Validation strategy:

    • Targeted experiments to confirm key predictions

    • Perturbation studies of identified pathways

    • Temporal profiling to establish causality

This integrated approach enables researchers to place YAL042C-A within its broader cellular context, generating testable hypotheses about its function that can drive focused experimental investigation.

What are the recommended standardized protocols for studying YAL042C-A?

Based on current knowledge and best practices, the following standardized protocols are recommended for YAL042C-A research:

  • Gene manipulation and strain construction:

    • CRISPR-Cas9 based knockout construction

    • Genomic tagging at C-terminus to preserve native regulation

    • Complementation testing with plasmid-based expression

  • Protein expression and purification:

    • E. coli expression with SUMO fusion tag

    • Two-step purification (IMAC followed by size exclusion)

    • Quality control using SDS-PAGE and mass spectrometry

  • Functional characterization:

    • Growth phenotyping under standard and stress conditions

    • Localization studies using confocal microscopy

    • Interaction mapping using AP-MS

  • Data analysis pipeline:

    • Standard workflow for RNA-seq analysis

    • Proteomics data processing workflow

    • Integration framework for multi-omics data

These standardized protocols facilitate reproducibility and enable meaningful comparison of results across different research groups studying this uncharacterized protein.

What control experiments are essential when studying YAL042C-A?

Rigorous controls are crucial for reliable research on uncharacterized proteins:

  • Genetic controls:

    • Empty vector controls for overexpression studies

    • Wild-type strain paired with knockout strain

    • Complementation with native gene to verify phenotype specificity

  • Protein interaction controls:

    • Unrelated protein with same tag for background binding

    • Reciprocal tagging of interaction partners

    • Competition assays to verify specificity

  • Localization controls:

    • Known markers for subcellular compartments

    • Multiple tagging strategies (N- and C-terminal)

    • Fixed and live cell imaging comparisons

  • Expression analysis controls:

    • Housekeeping genes for normalization

    • Time course measurements to capture dynamics

    • Multiple biological replicates (minimum n=3)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.