Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBL070C (YBL070C)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Classification

YBL070C is classified as a "dubious open reading frame" in the Saccharomyces Genome Database (SGD), which indicates that it is unlikely to encode a functional protein based on available experimental and comparative sequence data . It is also referred to as YBL0616 in some database entries . The classification as a dubious ORF is significant because it suggests that, despite being identified as a potential coding sequence in the yeast genome, current evidence suggests it may not produce a functional protein in vivo.

This classification is typically assigned based on various criteria, including:

  • Lack of conservation across related species

  • Absence of typical gene features

  • Limited evidence of expression

  • Possible overlap with functional genomic elements

Despite this classification, the fact that YBL070C can be successfully expressed as a recombinant protein indicates that the sequence can at least be translated into a stable polypeptide under certain conditions.

Protein Interactions and Functional Associations

Despite being classified as a dubious ORF, YBL070C shows predicted functional associations with several other proteins according to the STRING database, suggesting potential biological contexts in which it might operate.

Table 1: Predicted Functional Partners of YBL070C

Partner ProteinDescriptionInteraction ScoreReference
YJL119CPutative uncharacterized protein; Dubious open reading frame; unlikely to encode a functional protein0.914
YOR387CVEL1-related protein; Putative protein of unknown function; regulated by the metal-responsive Aft1p transcription factor; highly inducible in zinc-depleted conditions0.759

These predicted interactions are particularly intriguing because they connect YBL070C with both another dubious ORF (YJL119C) and a protein (YOR387C) that responds to specific cellular conditions, particularly zinc depletion . This suggests that if YBL070C is expressed under certain conditions, it might be involved in metal homeostasis pathways or stress responses.

The high interaction score (0.914) with YJL119C, another dubious ORF, raises interesting questions about potential functional relationships between these putative proteins. Both may be expressed under specific conditions or might represent evolutionary remnants with reduced or altered functionality.

Expression and Regulation

Information about the natural expression and regulation of YBL070C is limited in the available literature. As a dubious ORF, YBL070C may not be expressed under standard laboratory conditions, or its expression might be restricted to specific environmental stresses or developmental stages.

The predicted functional association with YOR387C, which is regulated by the metal-responsive Aft1p transcription factor and highly inducible in zinc-depleted conditions , provides a potential clue to conditions under which YBL070C might be expressed. This suggests possible involvement in cellular responses to metal availability, particularly zinc.

A comprehensive genome-wide study on phenotypically distinct subpopulations in adapting S. cerevisiae cultures mentioned variations in protein expression under glucose-limited conditions , though YBL070C was not specifically highlighted in the results. This type of study represents approaches that might eventually clarify the expression patterns of putative proteins like YBL070C under various stress conditions.

Research Applications

Despite uncertainty about its natural function, recombinant YBL070C protein enables various research applications:

Interaction Studies

Recombinant YBL070C can be used in binding assays to validate predicted protein-protein interactions, particularly with YJL119C and YOR387C. Techniques such as pull-down assays, co-immunoprecipitation, or surface plasmon resonance could confirm these interactions and identify additional binding partners.

Functional Characterization

Despite being classified as a dubious ORF, YBL070C might have unrecognized functions under specific conditions. The recombinant protein could be used in functional assays, particularly those related to metal homeostasis given its predicted association with YOR387C.

Antibody Production

The purified recombinant protein can serve as an antigen for antibody production, enabling the development of tools for detecting endogenous YBL070C expression under various conditions.

Genome Annotation Studies

As a dubious ORF, YBL070C represents an interesting case study for improving genome annotation methods and understanding the evolution of genomic elements.

Current Research and Future Perspectives

YBL070C appears primarily in genome-wide studies rather than targeted investigations. Recombinant protein-RNA interaction predictions database entries suggest potential RNA interactions involving similar yeast proteins, though specific data for YBL070C is limited .

In computational studies, YBL070C is typically included in analyses of the yeast genome. For example, a comprehensive study of protein coding genes in the yeast genome based on characteristic sequences identified approximately 5897 protein-coding genes , though the status of YBL070C as a functional gene remains uncertain.

Future research directions for YBL070C might include:

  1. Transcriptomic and proteomic analyses under various stress conditions to determine if YBL070C is expressed under specific circumstances, particularly metal deficiency conditions.

  2. Functional characterization through genetic approaches such as overexpression studies or examination of potential phenotypes in specialized conditions.

  3. Structural analyses of the recombinant protein to identify potential functional domains or structural similarities to characterized proteins.

  4. Evolutionary analyses to understand the origin and conservation of this genomic region across different yeast species and strains.

  5. Investigation of potential non-coding functions of the YBL070C genomic locus, as some dubious ORFs may represent regulatory elements rather than protein-coding genes.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during production. To request a specific tag type, please specify this in your order; we will prioritize fulfilling such requests.
Synonyms
YBL070C; YBL0616; Putative uncharacterized protein YBL070C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBL070C
Target Protein Sequence
MGPVLVWNISDLIGMNFTCLKGLATLFKTGASIGISLGAGAECSTIIACNLGSWFFKISL AIVQRLPLGMQCRICSFRNARQGGNIPELALIIICTFIYFLYFSLF
Uniprot No.

Target Background

Database Links

STRING: 4932.YBL070C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YBL070C and why is it classified as a putative uncharacterized protein?

YBL070C is an open reading frame (ORF) in the Saccharomyces cerevisiae genome that encodes a protein of unknown function. It is classified as "putative uncharacterized" because while sequence analysis confirms it as a protein-coding gene, its specific biological role remains undetermined. The characterization process typically begins with sequence homology analysis using tools like BLAST and HMMer to identify potential functional domains.

To determine whether YBL070C might contain any DNA-binding domains (DBDs), researchers can employ computational approaches similar to those used in the Codebook project, which characterized previously uncharacterized transcription factors. This approach combines sequence analysis with experimental validation to identify functional properties . For proteins like YBL070C that lack clear homology to well-characterized proteins, integrating multiple computational prediction methods with targeted experimental approaches is necessary for functional annotation.

What expression systems are most effective for producing recombinant YBL070C?

Based on established protocols for similar yeast proteins, multiple expression systems can be employed for YBL070C production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsOptimal For
FLiP-in HEK293 cellsPost-translational modifications similar to native eukaryotic proteinsRequires doxycycline induction (24h optimal)Full-length protein expression with proper folding
PURExpress T7 IVT systemRapid production, suitable for high-throughput studiesLimited post-translational modificationsDNA-binding domain constructs
SP6-driven wheat germ extract IVTGood for difficult-to-express eukaryotic proteinsIntermediate yieldFull-length or partial constructs

For YBL070C expression, the selection between these systems should be based on experimental goals. For binding studies, bacterial expression with N-terminal tags (such as GST or eGFP) often provides sufficient yields . If post-translational modifications are suspected to be important for YBL070C function, the mammalian expression system would be more appropriate, following protocols that have been successful for other yeast proteins .

How can I determine the subcellular localization of YBL070C?

To determine the subcellular localization of YBL070C, a systematic approach combining predictive algorithms and experimental validation is recommended:

  • Begin with bioinformatic prediction tools such as PSORT, TargetP, and DeepLoc to identify potential targeting sequences.

  • Generate a YBL070C-GFP fusion construct using a yeast-optimized expression vector with the TEF2 constitutive promoter, similar to systems used for other yeast proteins .

  • Transform the construct into a wild-type S. cerevisiae strain using the lithium acetate method.

  • Visualize the localization pattern using confocal microscopy, counter-staining with organelle-specific dyes:

    • DAPI for nucleus

    • MitoTracker for mitochondria

    • ER-Tracker for endoplasmic reticulum

  • Perform subcellular fractionation followed by Western blot analysis with anti-GFP antibodies to confirm microscopy observations.

These methods have been successfully employed for characterizing other putative proteins in S. cerevisiae and provide reliable data on protein localization that can inform functional studies .

How can I determine if YBL070C has DNA-binding properties similar to other uncharacterized transcription factors?

To assess potential DNA-binding properties of YBL070C, a multi-platform approach similar to that used in the Codebook project is recommended:

  • Computational analysis: First, analyze the YBL070C sequence for known DNA-binding domains using tools like HMMER and Pfam. Even proteins without canonical DBDs may have DNA-binding capabilities through novel domains, as observed with CGGBP1, NACC2, and other proteins initially thought to lack DBDs .

  • Experimental validation: Employ multiple complementary techniques:

    a. Protein-Binding Microarrays (PBMs): Test YBL070C on different array designs (HK and ME) to capture diverse binding preferences. PBMs are particularly effective for proteins with AT-hook-like motifs .

    b. HT-SELEX: Perform iterative selection of oligonucleotides binding to YBL070C, which has proven especially effective for C2H2-zinc finger proteins .

    c. ChIP-seq: If antibodies against YBL070C are unavailable, express tagged versions in yeast cells and perform ChIP-seq to identify genomic binding sites .

    d. SMiLE-seq: This method combines microfluidics with SELEX and provides high-resolution binding data with minimal protein requirements .

  • Data analysis: Apply multiple motif derivation tools to each dataset, as no single algorithm is universally optimal. Score motifs using metrics like AUROC and AUPRC on both training and independent test data .

This multi-platform approach addresses the variability in assay performance across different protein classes and has successfully characterized hundreds of previously uncharacterized transcription factors .

What experimental approaches are recommended for characterizing protein-protein interactions involving YBL070C?

To characterize protein-protein interactions of YBL070C, employ a tiered experimental strategy:

  • Yeast two-hybrid (Y2H) screening:

    • Create bait constructs containing full-length YBL070C and domain-specific constructs (if domains are predicted)

    • Screen against a comprehensive S. cerevisiae genomic library

    • Validate positive interactions through reverse Y2H and co-immunoprecipitation

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged YBL070C (TAP-tag or FLAG-tag) in S. cerevisiae

    • Isolate protein complexes under near-physiological conditions

    • Identify interaction partners through LC-MS/MS

    • Quantify interaction strength using SAINT or CompPASS algorithms

  • Proximity-dependent biotin identification (BioID):

    • Generate a fusion protein of YBL070C with a promiscuous biotin ligase

    • Express in yeast cells and allow biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures transient interactions missed by AP-MS

  • Validation with co-immunoprecipitation and FRET:

    • Confirm key interactions using reciprocal co-IP experiments

    • For spatial resolution, perform Förster Resonance Energy Transfer (FRET) with fluorescently tagged proteins

These complementary approaches provide a comprehensive interactome map, which can significantly accelerate functional characterization of YBL070C by placing it in specific biological pathways and processes.

How do I analyze contradictory experimental results regarding YBL070C function?

When encountering contradictory results about YBL070C function, employ systematic contradiction detection and resolution strategies:

  • Classify contradiction types: Categorize contradictions based on their nature, such as:

    • Negation contradictions (direct opposite findings)

    • Antonymy contradictions (complementary but opposing results)

    • Numeric mismatches (different quantitative outcomes)

    • Methodological contradictions (same question, different experimental approaches)

  • Apply a structured resolution framework:

    Contradiction TypeAnalysis ApproachResolution Strategy
    Experimental conditionsCompare buffer compositions, temperatures, strain backgroundsRepeat experiments under standardized conditions
    Protein constructsAnalyze differences in tags, truncationsTest multiple constructs systematically
    Detection methodsAssess sensitivity and specificity of each methodUse orthogonal validation approaches
    Data interpretationExamine statistical methods and thresholdsApply unified analytical pipeline to raw data
  • Generate testable hypotheses: Formulate specific hypotheses that could explain the contradictory results, such as:

    • YBL070C function depends on specific post-translational modifications

    • Different experimental conditions reveal context-dependent functions

    • Strain-specific genetic backgrounds influence YBL070C activity

  • Design critical experiments: Develop targeted experiments specifically designed to resolve the contradictions, rather than simply repeating previous work .

This systematic approach to contradiction analysis often leads to deeper insights into protein function, as apparent contradictions frequently reflect context-dependent activities or multiple functions of the same protein.

What are the optimal conditions for expressing recombinant YBL070C in S. cerevisiae?

For optimal expression of recombinant YBL070C in S. cerevisiae, the following conditions should be systematically tested and optimized:

  • Vector selection and design:

    • Use a high-copy 2μm expression plasmid with the constitutive TEF2 promoter for strong, consistent expression

    • Include a C-terminal tag (6xHis or FLAG) for purification, as N-terminal tags may interfere with targeting signals

    • Consider codon optimization if expression levels are low

  • Expression conditions optimization:

    ParameterRange to TestMonitoring Method
    Growth temperature20°C, 25°C, 30°CGrowth curves, protein yield
    Media compositionYPD, SC, YP+2% galactoseProtein expression level by Western blot
    Growth phaseEarly log, mid-log, late logProtein quality and yield
    Induction time (if inducible)4h, 8h, 24hExpression level and protein solubility
  • Strain selection:

    • Test protease-deficient strains (pep4Δ) to reduce degradation

    • Consider chaperone-overexpressing strains for improved folding

    • Use BJ5464 or BY4741 backgrounds for initial trials

  • Purification optimization:

    • Test both native and denaturing conditions for affinity purification

    • Optimize buffer compositions to maintain protein stability

    • Consider on-column refolding if the protein forms inclusion bodies

Each parameter should be systematically tested and optimized using a design of experiments (DOE) approach to identify interactions between variables that affect expression and protein quality. Western blotting and activity assays should be performed at each optimization step to ensure the protein is properly expressed and functional.

What genome-wide approaches can be used to identify the biological function of YBL070C?

To comprehensively identify the biological function of YBL070C, multiple genome-wide approaches should be integrated:

  • Systematic genetic interaction mapping:

    • Generate YBL070C deletion strain and synthetic genetic array (SGA) analysis

    • Create temperature-sensitive or auxin-inducible degron alleles if YBL070C is essential

    • Map negative and positive genetic interactions across the genome

    • Cluster the genetic interaction profile with known genes to identify functional relationships

  • Transcriptome analysis under YBL070C perturbation:

    • Perform RNA-seq comparing wild-type vs. YBL070C deletion or overexpression

    • Analyze differential expression patterns under various stress conditions

    • Use gene set enrichment analysis (GSEA) to identify affected pathways

  • Proteome-wide approaches:

    • Conduct global proteomics analysis before and after YBL070C deletion/overexpression

    • Perform phosphoproteomics to identify signaling pathways affected

    • Use SILAC or TMT labeling for quantitative comparisons

  • Metabolomic profiling:

    • Analyze metabolite changes in YBL070C mutants under different conditions

    • Focus on pathways suggested by other omics approaches

    • Validate key metabolic changes with targeted assays

  • Integration of multiple data types:

    Data TypePrimary InformationSecondary Analysis
    Genetic interactionsFunctional pathwaysBuffering relationships
    TranscriptomicsRegulatory effectsTranscription factor predictions
    ProteomicsProtein abundance changesPost-translational modifications
    MetabolomicsMetabolic impactsEnzyme activity inference
  • Computational integration:

    • Apply machine learning approaches to integrate diverse datasets

    • Use network analysis to predict function based on connectivity patterns

    • Validate computational predictions with focused experiments

This multi-omics approach has successfully elucidated functions of previously uncharacterized proteins in S. cerevisiae and provides a comprehensive framework for functional discovery .

How should I approach sequence-specificity analysis if YBL070C shows DNA-binding properties?

If YBL070C demonstrates DNA-binding properties, apply the following sequence-specificity analysis workflow:

  • Generate binding data using multiple platforms:

    • Perform ChIP-seq if YBL070C binds DNA in vivo

    • Use in vitro methods like HT-SELEX, PBMs, and SMiLE-seq to determine direct binding preferences

    • Apply all methods in parallel as they may capture different aspects of binding specificity

  • Apply multiple motif derivation algorithms to each dataset:

    • Use MEME, HOMER, DREME, and other specialized tools

    • Compare position weight matrices (PWMs) generated by different algorithms

    • Select the best-performing motifs based on cross-validation metrics

  • Validate motifs across independent datasets:

    • Test motifs derived from one experiment on data from other experimental platforms

    • Calculate AUROC and AUPRC scores to assess motif quality

    • Refine motifs iteratively to improve performance

  • Compare with known DBD families:

    • Analyze whether YBL070C binding resembles established DBD family patterns

    • Determine if it fits into known classes (C2H2-zf, homeodomain, etc.) or represents a novel DBD class

    • Consider that YBL070C might contain underappreciated DNA-binding domains, similar to CGGBP1 or NACC2

  • Structural interpretation of binding specificity:

    • If possible, model the YBL070C DBD structure using AlphaFold or similar tools

    • Identify potential DNA-contacting residues

    • Validate through targeted mutagenesis of predicted contact residues

This comprehensive approach to sequence-specificity analysis has successfully characterized numerous previously uncharacterized transcription factors and can provide detailed insights into YBL070C's potential role in transcriptional regulation .

What statistical approaches should I use when analyzing contradictory experimental results for YBL070C?

When faced with contradictory experimental results for YBL070C, apply these statistical approaches to resolve discrepancies:

These statistical approaches provide a structured framework for analyzing seemingly contradictory results and often reveal conditional effects or context-dependent functions that explain apparent discrepancies in experimental outcomes for YBL070C or similar uncharacterized proteins.

How can YBL070C be utilized in recombinant protein expression systems if it has chaperone-like properties?

If YBL070C demonstrates chaperone-like properties, it can be strategically utilized in recombinant protein expression systems:

  • Co-expression strategies:

    • Design bi-cistronic vectors expressing both YBL070C and target protein

    • Create operon-like constructs with optimized spacing between genes

    • Test inducible vs. constitutive YBL070C expression to determine optimal timing

  • Host strain engineering:

    • Develop S. cerevisiae strains with genomically integrated, regulatable YBL070C

    • Create conditional expression systems using temperature-sensitive promoters

    • Generate strains with varying YBL070C expression levels to optimize for different target proteins

  • Optimization for specific protein classes:

    Target Protein ClassYBL070C ApplicationExpected Benefit
    Membrane proteinsCo-expression during inductionImproved folding and membrane insertion
    Large multi-domain proteinsEarly expression before target inductionPrevention of premature folding/aggregation
    Proteins prone to aggregationConstitutive expression at moderate levelsReduced inclusion body formation
    Proteins requiring specific PTMsCo-expression with PTM enzymes and YBL070CCoordinated folding and modification
  • Fusion protein approaches:

    • Design cleavable YBL070C-fusion constructs

    • Test N-terminal, C-terminal, and internal fusion configurations

    • Optimize linker sequences for effective chaperone activity

  • Scale-up considerations:

    • Develop fed-batch protocols that maintain optimal YBL070C:target protein ratios

    • Monitor protein quality attributes throughout production

    • Implement process analytical technology (PAT) for real-time adjustment of expression conditions

These approaches have been successful with other chaperone proteins in S. cerevisiae and could be adapted for YBL070C if it demonstrates similar properties, potentially improving the production of difficult-to-express recombinant proteins for research applications .

What are the implications of YBL070C potential involvement in DNA repair mechanisms?

If YBL070C is implicated in DNA repair mechanisms, several important research directions and applications emerge:

  • Comprehensive DNA damage response profiling:

    • Test YBL070C deletion/overexpression strains against various DNA damaging agents:

      • UV radiation (nucleotide excision repair pathway)

      • Methylmethane sulfonate (base excision repair)

      • Gamma radiation (double-strand break repair)

      • Cisplatin (interstrand crosslink repair)

    • Measure survival rates, growth kinetics, and mutation frequencies

  • Pathway-specific analysis:

    • Perform epistasis analysis with known DNA repair genes

    • Create double mutants with key repair pathway components

    • Use genetic interaction mapping to place YBL070C in specific repair pathways

  • Mechanistic investigations:

    • Analyze YBL070C recruitment to damaged DNA using ChIP-seq after damage induction

    • Identify YBL070C binding partners during normal conditions vs. after DNA damage

    • Characterize enzymatic activities (helicase, nuclease, ligase, etc.)

  • Evolutionary conservation analysis:

    • Compare YBL070C function across species with orthologs

    • Identify conserved domains and critical residues

    • Analyze selective pressure on YBL070C sequence as indicator of importance

  • Translational implications:

    Research AreaPotential ApplicationExperimental Approach
    Cancer biologySynthetic lethality with oncogenesScreen cancer cell dependencies
    Aging researchRole in age-related DNA damageLifespan studies in YBL070C mutants
    Genome stabilityPrevention of genomic rearrangementsMeasure chromosomal aberration rates
    Stress responseProtection against environmental damageTest resistance to oxidative stress

Understanding YBL070C's role in DNA repair would have significant implications for multiple fields, potentially revealing new therapeutic targets or biomarkers for diseases associated with genome instability, such as cancer and neurodegenerative disorders.

What are the most promising approaches for characterizing protein-protein interaction networks involving YBL070C?

To comprehensively characterize protein-protein interaction networks involving YBL070C, integrate these state-of-the-art approaches:

  • Proximity-dependent labeling technologies:

    • Apply BioID or TurboID by fusing YBL070C to a promiscuous biotin ligase

    • Use APEX2 for temporal resolution of interaction dynamics

    • Compare interactomes under different cellular conditions and stresses

  • Crosslinking mass spectrometry (XL-MS):

    • Employ protein-protein crosslinking followed by MS identification

    • Apply both homo- and hetero-bifunctional crosslinkers of different lengths

    • Create distance constraint maps to inform structural modeling

  • Integrative network analysis:

    • Combine physical interaction data with genetic interaction profiles

    • Apply network alignment algorithms to identify evolutionarily conserved modules

    • Use supervised machine learning to predict additional interactions

  • Protein complementation assays:

    • Implement split reporter systems (BiFC, DHFR, luciferase)

    • Screen for interactions in high-throughput format

    • Visualize interactions in different cellular compartments

  • Single-molecule techniques:

    • Apply FRET, FLIM, or FCS to study interaction dynamics

    • Determine kinetic parameters of key interactions

    • Investigate formation and composition of YBL070C-containing complexes

  • Computational network integration:

    Data TypeIntegration MethodOutput
    Physical interactionsBayesian integrationConfidence-scored interaction network
    Co-expressionPearson/Spearman correlationFunctionally related genes
    Co-evolutionStatistical coupling analysisEvolutionarily linked proteins
    Multi-omicsNetwork propagation algorithmsPathway membership prediction
  • Validation and functional testing:

    • Mutate key interface residues to disrupt specific interactions

    • Perform phenotypic analysis of interaction-deficient mutants

    • Use optogenetic approaches to temporally control interactions

This multi-layered approach to protein interaction network mapping has proven successful for characterizing previously uncharacterized proteins and would provide comprehensive insights into YBL070C's functional context within the cell .

How can contradictory experimental results about YBL070C help refine our understanding of its function?

Contradictory experimental results, when properly analyzed, can significantly refine our understanding of YBL070C function through these approaches:

  • Contradiction classification and hypothesis generation:

    • Apply formal contradiction detection methods to systematically classify discrepancies

    • Generate testable hypotheses that could explain seemingly contradictory observations

    • Develop a contradiction resolution framework specific to protein function determination

  • Context-dependency mapping:

    • Design experiments to test if YBL070C function varies based on:

      • Cell cycle phase

      • Nutrient conditions

      • Stress responses

      • Genetic background

    • Create a context-function matrix to map condition-specific roles

  • Multi-functionality exploration:

    • Test whether YBL070C performs different functions in different cellular compartments

    • Investigate potential moonlighting functions using targeted assays

    • Create domain-specific deletion constructs to map function to structure

  • Post-translational modification profiling:

    • Map phosphorylation, acetylation, and other modifications across conditions

    • Determine if modifications switch YBL070C between different functional states

    • Create modification-mimicking mutants to test functional hypotheses

  • Epistasis analysis to resolve pathway placement:

    • Create double mutants with genes in pathways where YBL070C shows contradictory placement

    • Analyze genetic interaction patterns to resolve pathway membership

    • Use quantitative phenotyping to capture subtle functional relationships

  • Integrative modeling approach:

    Contradiction TypeResolution ApproachExpected Outcome
    Different binding partnersCondition-specific interaction mappingDefined interaction network contexts
    Divergent phenotypesSynthetic genetic interaction screeningPathway-specific functionality map
    Localization differencesTime-resolved imagingTemporal pattern of localization
    Opposing biochemical activitiesSubstrate and cofactor screeningRegulatory mechanism identification

By systematically analyzing and resolving contradictions, researchers can develop a more nuanced understanding of YBL070C function that incorporates condition-specificity, multiple roles, and regulatory mechanisms - turning apparent contradictions into valuable insights about protein multifunctionality .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.