The YBL071C gene is located on chromosome II (coordinates: 90223..90531) in the S288c reference strain . Key features include:
| Attribute | Value |
|---|---|
| Gene ID | YBL071C |
| Protein Length | 103 amino acids |
| UniProt ID | P38185 |
| Chromosomal Location | Chr II: 90223..90531 |
| Essentiality | Non-essential |
| Conservation | Conserved among S. cerevisiae strains |
The gene is part of the YBL0615 ORF family and has a paralog, YBL071C-B, which shares similar characteristics but lacks functional annotations .
The full-length protein (1–102 aa) has the following sequence:
MILLKSEHGGKRKEMRQDDLMGPNHFSLRIMYKIIIYTYPVSLYAVKELNLSKTFSISALGILNSNSNRSPAKKQTFFSACVAKSYSSFFISICILDLASHL .
Recombinant YBL071C is produced in diverse hosts:
| Host System | Tag | Purity | Source |
|---|---|---|---|
| E. coli | His-tag | >90% (SDS-PAGE) | |
| E. coli/Yeast | Untagged | ≥85% (SDS-PAGE) | |
| Cell-free systems | N/A | ≥85% (SDS-PAGE) |
Purification buffers typically include Tris-based formulations with glycerol for stability .
A YBL071C knockout strain (RNSS-4740573) in the BY4743 background shows no viability defects, confirming the gene is non-essential . Key attributes:
| Parameter | Detail |
|---|---|
| Culture Medium | YPD broth with G418 (200 µg/mL) |
| Storage | Frozen at -80°C, stable for ≥12 months |
| Functional Role | Unknown; no phenotypic changes observed in standard growth conditions |
BioGRID data reveal 42 unique protein interactions, though specific functional roles remain undefined . These include:
Genetic Interactions: Potential regulatory or cooperative roles in uncharacterized pathways.
Physical Interactions: Observed via high-throughput methods but lack mechanistic validation .
YBL071C is used to study:
Protein Structure: Full-length His-tagged versions enable crystallography or NMR studies .
Antigenicity: Recombinant proteins serve as antigens for antibody production .
Rabbit polyclonal antibodies (e.g., against YBL071C or YBL071C-B) are validated for:
KEGG: sce:YBL071C
STRING: 4932.YBL071C
YBL071C is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast) consisting of 102 amino acids. Its significance stems from being part of the broader study of uncharacterized yeast proteins, which often reveal fundamental cellular processes. As with many putative proteins, researchers approach YBL071C using systematic characterization methods to determine its structure, localization, and function. The methodological approach begins with bioinformatic analysis (sequence homology, structural predictions) followed by experimental validation through techniques such as fluorescent tagging for localization studies, affinity purification for interaction partners, and phenotypic analysis of deletion strains . The protein's small size (102 amino acids) suggests it may function as a regulatory element rather than an enzymatic protein, making it potentially significant for understanding cellular signaling pathways in eukaryotes.
The primary expression system utilized for recombinant YBL071C production is E. coli, which allows for high-yield protein expression with His-tagging for purification purposes . Methodologically, researchers should consider several factors when selecting an expression system:
For structural studies requiring post-translational modifications, yeast-based expression systems (P. pastoris or S. cerevisiae) may provide advantages over bacterial systems
For high-throughput functional analysis, bacterial systems offer cost-effective production
For interaction studies, mammalian expression systems might provide more relevant folding environments
When designing expression constructs, consider:
| Expression System | Advantages | Disadvantages | Optimal Applications |
|---|---|---|---|
| E. coli | High yield, cost-effective, simple purification | Limited post-translational modifications | Structural studies, antibody production |
| S. cerevisiae | Native environment, proper folding | Lower yield | Functional studies, interaction analysis |
| P. pastoris | High yield, proper folding | More complex setup | Large-scale production for biochemical studies |
| Mammalian cells | Mammalian-like modifications | Expensive, complex | Cross-species interaction studies |
The methodological workflow typically involves cloning the YBL071C sequence with appropriate tags, optimizing expression conditions (temperature, induction timing, media composition), and establishing a purification protocol specific to the expressed construct .
While definitive structural data for YBL071C is limited, several methodological approaches can be employed to predict its structural features. Computational prediction algorithms suggest YBL071C likely contains 1-2 alpha-helical regions based on its amino acid composition, with potential disordered regions that may facilitate protein-protein interactions. The methodological approach should involve:
Primary sequence analysis using tools like BLAST, Pfam, and SMART to identify conserved domains
Secondary structure prediction using PSIPRED or JPred
3D structure prediction using AlphaFold2 or RoseTTAFold
Disorder prediction using IUPred or PONDR
Experimentally, circular dichroism spectroscopy can verify secondary structure content, while NMR or X-ray crystallography would provide definitive structural information for this relatively small protein. The absence of well-defined domains in database searches suggests YBL071C may represent a lineage-specific adaptation in Saccharomyces yeasts, requiring comparative genomics approaches across related fungal species to identify evolutionary patterns .
Designing experiments to investigate YBL071C's potential role in cold adaptation requires a systematic approach comparing wild-type and YBL071C-deficient strains. Based on established cold adaptation research methodologies, follow this experimental design:
Generate YBL071C deletion strains using CRISPR-Cas9 or traditional homologous recombination techniques
Design temperature challenge experiments:
Growth curve analysis at optimal (30°C) versus cold temperatures (10-15°C)
Colony formation efficiency comparisons at various temperatures
Competitive growth assays with wild-type and mutant strains
Assess molecular responses:
Transcriptome analysis (RNA-seq) comparing gene expression patterns
Proteome profiling to identify compensatory protein expression
Mitochondrial function assessment (oxygen consumption, membrane potential)
Include appropriate controls such as known cold-sensitive mutants (e.g., YME1 or DRS2) and cold-tolerant strains . Statistical analysis should employ two-way ANOVA to evaluate interaction effects between genotype and temperature.
| Strain | Growth at 30°C (YPD) | Growth at 30°C (YPEG) | Growth at 15°C (YPD) | Growth at 15°C (YPEG) |
|---|---|---|---|---|
| Wild-type | +++ | +++ | ++ | ++ |
| ΔyBL071C | To be determined | To be determined | To be determined | To be determined |
| ΔDRS2 (control) | +++ | +++ | + | + |
Follow cold adaptation experimental protocols established for yeast, carefully controlling media composition, starter culture conditions, and growth phase at temperature shift to minimize experimental variability .
Identifying interaction partners of uncharacterized proteins like YBL071C requires complementary approaches that balance depth, specificity, and functional relevance. Implement the following methodological workflow:
Affinity purification-mass spectrometry (AP-MS):
Express His-tagged YBL071C in S. cerevisiae
Perform crosslinking to capture transient interactions
Purify using nickel affinity chromatography
Identify co-purifying proteins by LC-MS/MS
Filter against appropriate negative controls
Yeast two-hybrid (Y2H) screening:
Clone YBL071C as both bait and prey constructs
Screen against genomic libraries and targeted candidates
Validate interactions through co-immunoprecipitation
Proximity labeling approaches:
BioID or TurboID fusions to YBL071C
In vivo biotinylation of proximal proteins
Streptavidin pulldown and mass spectrometry
Computational prediction and co-expression analysis:
Network analysis using STRING, BioGRID
Co-expression datasets from stress response studies
When analyzing interaction data, prioritize proteins that appear across multiple methods, show stoichiometric levels in AP-MS, or have functional annotations related to your hypothesis . Interactions should be categorized based on confidence levels and verified through reciprocal tagging experiments.
Analyzing YBL071C expression under diverse stress conditions provides crucial insights into its potential functional roles. A comprehensive methodological approach involves:
Transcriptional profiling:
RT-qPCR analysis of YBL071C mRNA levels
RNA-seq to place changes in genome-wide context
Time-course analysis to capture transient responses
Protein-level analysis:
Western blot with antibodies against tagged YBL071C
Quantitative proteomics (SILAC or TMT labeling)
Protein stability assessment with cycloheximide chase
Stress conditions to test:
Temperature stress (heat shock, cold shock)
Oxidative stress (H₂O₂, menadione)
Osmotic stress (high salt, sorbitol)
Nutrient limitation (nitrogen, carbon, phosphate)
DNA damage (UV, MMS)
Proper experimental design requires precise control of growth conditions, synchronized cultures, and multiple biological replicates. Analysis should include comparison to known stress-responsive genes as internal controls. Expression changes should be correlated with phenotypic observations in deletion strains under the same conditions to establish functional relevance . Where appropriate, use GFP-fusion proteins to track subcellular localization changes under stress conditions.
Positive controls:
Negative controls:
Media controls:
Test both fermentable (YPD) and non-fermentable (YPEG) carbon sources
Minimal media and complete media comparisons
Temperature regime controls:
Standardized temperature points (30°C as permissive, 15°C as cold)
Temperature shift protocols with controlled rates
Recovery experiments at permissive temperature
Strain background controls:
Use multiple strain backgrounds if possible
Ensure genetic markers are consistent across test strains
This experimental design allows for clear differentiation between general growth defects and specific cold-sensitive phenotypes . The table of results should follow the format shown in search result , capturing growth comparisons across different media and temperatures for multiple strain types.
Characterizing YBL071C's role in cellular pathways requires a systematic experimental approach that integrates genetic, biochemical, and computational methods. The methodological framework should include:
Genetic interaction mapping:
Synthetic genetic array (SGA) analysis
Targeted epistasis experiments with related genes
Suppressor screens to identify compensatory pathways
Quantitative scoring of genetic interactions
Pathway perturbation experiments:
Chemical inhibition of major cellular pathways
Monitor YBL071C deletion effects on pathway outputs
Measure biochemical endpoints relevant to hypothesized pathways
Systems-level analysis:
Multi-omics integration (transcriptomics, proteomics, metabolomics)
Network analysis to place YBL071C in known pathway maps
Enrichment analysis for biological processes
Variable manipulation following experimental design principles:
Implement randomization to control for batch effects and systematic biases, with appropriate statistical analysis using methods such as ANOVA for multi-factorial designs or regression analysis for continuous variables . Document all experimental conditions meticulously to ensure reproducibility, and consider both loss-of-function and gain-of-function approaches to fully characterize the protein's role.
Detecting post-translational modifications (PTMs) of YBL071C requires specialized techniques that can identify and characterize specific chemical modifications. The methodological workflow should include:
Initial PTM prediction:
Computational analysis using tools like NetPhos, UbPred, and SUMOplot
Sequence motif analysis for established modification sites
Structural modeling to identify surface-accessible residues
Mass spectrometry-based approaches:
Immunoprecipitation of tagged YBL071C
Sample preparation optimized for specific PTM types:
Phosphorylation: TiO₂ enrichment
Ubiquitination: Tryptic digestion preserving GG remnants
Glycosylation: Lectin enrichment or PNGase treatment
LC-MS/MS analysis with neutral loss scanning
Data analysis with appropriate search parameters for modifications
Biochemical validation:
Phospho-specific antibodies if available
Mobility shift assays (Phos-tag gels for phosphorylation)
Enzymatic treatments (phosphatases, deubiquitinases)
Site-directed mutagenesis of predicted modification sites
Dynamic PTM analysis:
Time-course experiments during stress responses
Inhibitor treatments to block specific modification pathways
Document the mass accuracy, peptide coverage, and statistical confidence for each identified modification. Present results in tabular format with modification sites, flanking sequences, and detection scores. Validate key findings with orthogonal methods whenever possible.
Resolving contradictory data about YBL071C's function requires systematic evaluation of experimental evidence and methodological differences. Apply this analytical framework:
Evaluate methodological differences:
Compare experimental conditions (strains, media, temperatures)
Assess measurement techniques (direct vs. indirect readouts)
Consider temporal aspects (acute vs. chronic responses)
Evaluate specific reagents used (antibodies, constructs)
Implement contradiction detection approaches:
Resolution strategies:
Design focused experiments targeting contradiction points
Implement orthogonal approaches to validate key findings
Consider context-dependent functions (condition-specific roles)
Evaluate potential strain background effects
Computational integration:
Bayesian analysis to weight contradictory evidence
Machine learning approaches to identify patterns across datasets
Network analysis to place contradictory results in pathway context
When presenting contradictory findings, use a structured comparison table highlighting differences in experimental conditions, measured variables, and statistical significance . This approach acknowledges that apparent contradictions may represent context-dependent functions rather than experimental errors.
Selecting appropriate statistical approaches for YBL071C phenotypic data analysis depends on experimental design and data characteristics. The methodological framework should include:
Experimental design considerations:
Data preprocessing:
Assess normality with Shapiro-Wilk or Kolmogorov-Smirnov tests
Transform data if necessary (log, square root)
Identify and address outliers with standardized approaches
Normalize to appropriate controls
Statistical test selection:
For comparing two conditions: t-test (parametric) or Mann-Whitney (non-parametric)
For multiple conditions: ANOVA with appropriate post-hoc tests
For growth curves: area under curve analysis or growth rate comparisons
For genetic interaction data: multiplicative or additive interaction models
Multiple testing correction:
Apply Bonferroni correction for stringent analysis
Use Benjamini-Hochberg for controlling false discovery rate
Report both raw and adjusted p-values
Effect size reporting:
Include Cohen's d, fold change, or percent difference
Present confidence intervals alongside p-values
Use standardized plotting formats (box plots with data points)
When reporting results, clearly state all statistical parameters, including test types, degrees of freedom, test statistics, and precise p-values . This transparency enables proper evaluation of findings and facilitates meta-analysis across studies.
Based on potential parallels with other yeast proteins that interact with nuclear pore complexes, several methodological approaches can determine if YBL071C has similar functions:
Fluorescence microscopy approaches:
Generate YBL071C-GFP fusion proteins
Co-localization studies with known nuclear pore markers (e.g., Nup188)
FRAP analysis to measure dynamics at the nuclear envelope
Live cell imaging during stress responses
Biochemical interaction studies:
Immunoprecipitation with nuclear pore complex proteins
Proximity labeling using BioID fused to NPC components
In vitro binding assays with recombinant proteins
Crosslinking mass spectrometry to capture interaction interfaces
Genetic interaction analysis:
Functional transport assays:
Nuclear import/export reporter assays in YBL071C mutants
mRNA export efficiency measurements
Protein localization studies under various conditions
Special attention should be given to cold temperature conditions, as some nuclear pore interactions may be conditional or stress-specific . Design experiments to test if YBL071C impacts dynactin-mediated transport to the nucleus, similar to the relationships observed with Arp1p and Nip100p .
Investigating YBL071C's potential role in mitochondrial processes under cold stress requires a methodological approach that builds on existing knowledge of yeast cold adaptation:
Mitochondrial phenotype characterization:
Electron microscopy to assess mitochondrial morphology
Mitochondrial membrane potential measurements
Oxygen consumption rates at different temperatures
mtDNA stability and copy number analysis
Genetic interaction studies:
Targeted biochemical analyses:
Measure oxidative stress markers in YBL071C mutants
Assess levels of reactive oxygen species
Quantify mitochondrial protein import efficiency
Analyze mitochondrial translation products
Transcriptome and proteome analysis:
RNA-seq comparing wild-type and ΔyBL071C responses to cold
Quantitative proteomics of purified mitochondria
Focus on retrograde signaling pathways
Similar to studies with YME1, investigate if YBL071C deletion causes accumulation of oxidative stress byproducts specifically at cold temperatures . Design experiments to test the theory that YBL071C may have redundant functions with other genes that become inactive at cold temperatures, thus creating conditional phenotypes only observable under specific stress conditions.
Based on current knowledge and research trends, the most promising directions for further characterizing YBL071C include:
Comprehensive phenomics screening:
High-resolution structural studies:
Cryo-EM or X-ray crystallography of the full protein
NMR for dynamic regions and interaction surfaces
Hydrogen-deuterium exchange mass spectrometry
Evolutionary analysis:
Comparative genomics across fungal species
Selection pressure analysis of sequence conservation
Identification of co-evolving partners
Systems-level integration:
Multi-omics data integration
Network-based function prediction
Machine learning approaches leveraging existing functional data