Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBL094C (YBL094C)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Commercial suppliers produce recombinant YBL094C for research applications. Key specifications include:

ParameterDetails
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ApplicationsSDS-PAGE, structural studies
SuppliersCreative BioMart, CUSABIO TECHNOLOGY LLC

Genetic and Functional Context

  • Genomic Context: YBL094C overlaps with YBL095W, another uncharacterized ORF, raising questions about its biological relevance .

  • Functional Annotations:

    • Labelled as a "dubious ORF" in the Saccharomyces Genome Database (SGD), with no direct evidence of translation or function .

    • No Gene Ontology (GO) terms or expression data available .

  • Interactions: Predicted to interact with proteins of unknown function (e.g., YML122C, YDR157W) via computational models .

Controversies and Limitations

  • Dubious ORF Status: Multiple databases classify YBL094C as non-functional due to:

    • Lack of transcriptional/translational evidence .

    • Overlap with adjacent genes .

  • Experimental Challenges:

    • Absence of detectable expression in native yeast .

    • No known post-translational modifications or binding partners .

Future Directions

  • Functional Validation: CRISPR-based knockout/knock-in studies to assess phenotypic impacts.

  • Structural Biology: X-ray crystallography or cryo-EM to resolve 3D conformation.

  • Pathway Mapping: Integration with multi-omics datasets to identify potential regulatory roles.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
YBL094C; YBL0836; Putative uncharacterized protein YBL094C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBL094C
Target Protein Sequence
MLFQNISSHLKYLNQVGSTRIQLALANFFAISCLWLKPQICGKFQLLVPFREETSNGNCS KCPSMIHFLPLISLTFAFSIIVVSTGMSSKNSSDSLAVTPLLLGNKGKPQ
Uniprot No.

Target Background

Database Links

STRING: 4932.YBL094C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YBL094C and why is it significant in yeast research?

YBL094C is a putative uncharacterized protein found in Saccharomyces cerevisiae (strain ATCC 204508/S288c), commonly known as baker's yeast. Despite being uncharacterized, this protein holds significance in fundamental yeast biology research as it represents one of many open reading frames (ORFs) whose functions remain to be fully elucidated. Saccharomyces cerevisiae serves as an excellent model organism for eukaryotic cell biology due to its genetic tractability, quick generation time, and conserved cellular processes. The study of uncharacterized proteins like YBL094C contributes to our understanding of the yeast proteome and potentially reveals novel functional pathways relevant to broader eukaryotic biology. Systematic approaches to characterizing such proteins often involve expression analysis, localization studies, and phenotypic screening of deletion or overexpression mutants .

How can researchers access reliable YBL094C antibodies for experimental applications?

Researchers can obtain validated antibodies against YBL094C from specialized immunological reagent suppliers that provide research-grade antibodies tested for specificity in relevant applications. When selecting an antibody, researchers should prioritize those raised against recombinant Saccharomyces cerevisiae YBL094C protein and validated for applications such as Western blotting and ELISA. Available commercial antibodies include polyclonal options such as the rabbit-derived, antigen-affinity purified antibody (e.g., CSB-PA327791XA01SVG) designed specifically for detection of YBL094C . For optimal results, researchers should:

  • Verify the antibody's reactivity against Saccharomyces cerevisiae (strain ATCC 204508/S288c)

  • Check validation data for specific applications (Western blotting, ELISA)

  • Consider the antibody format (non-conjugated vs. conjugated)

  • Review the storage requirements (typically -20°C or -80°C, avoiding repeated freeze-thaw cycles)

  • Examine the buffer composition (e.g., 50% glycerol, 0.01M PBS pH 7.4 with preservatives)

What are the current limitations in the functional annotation of YBL094C?

The functional annotation of YBL094C faces several limitations that hamper comprehensive characterization. The protein lacks definitive expression data in major databases such as the Saccharomyces Genome Database (SGD), as indicated by the notation "No expression data for YBL094C" . This absence of expression profiles complicates understanding of its regulation and potential biological roles. Furthermore, YBL094C's putative status suggests insufficient biochemical evidence to assign definitive functions, despite the extensive genetic tools available for yeast. Current limitations include:

  • Insufficient high-throughput data correlating YBL094C with specific cellular processes

  • Limited information about protein-protein interactions and complex formation

  • Absence of structural data that could suggest functional domains

  • Limited phenotypic data from systematic knockout or overexpression studies

  • Challenges in detecting low-abundance proteins in standard proteomics approaches

How should researchers design overexpression experiments to study YBL094C function?

When designing overexpression experiments for YBL094C functional analysis, researchers should implement a systematic approach that controls for multiple variables while monitoring specific cellular phenotypes. Based on established overexpression screening methodologies, the following experimental design is recommended:

First, construct an expression vector containing the YBL094C open reading frame under a regulatable promoter (such as GAL1) to enable controlled induction. Transform this construct into wild-type Saccharomyces cerevisiae and appropriate control strains. For rigorous experimental design, implement the following steps:

  • Include appropriate controls: empty vector, constitutive promoter controls, and overexpression of characterized proteins with known functions

  • Establish a dose-response curve using varying inducer concentrations to determine optimal expression levels

  • Monitor multiple cellular phenotypes, particularly focusing on vacuole morphology and endocytic protein trafficking pathways, as overexpression screens have successfully identified novel genes affecting these processes

  • Employ fluorescent markers for key cellular compartments to visually assess morphological changes

  • Combine with genetic approaches by introducing the overexpression construct into relevant mutant backgrounds to identify genetic interactions

This approach follows established protocols that have successfully identified novel genes involved in endocytic trafficking through visual screening of overexpression phenotypes .

What statistical considerations are essential when analyzing YBL094C expression data?

  • Data preprocessing: Apply appropriate log2 transformation and normalization to account for technical variability across samples, following standardized protocols used in expression databases like SPELL (Serial Pattern of Expression Levels Locator)

  • Hypothesis testing: Formulate clear null and alternative hypotheses regarding YBL094C expression changes across conditions. For example:

    • H0: "There is no difference in YBL094C expression between wild-type and treatment conditions"

    • H1: "YBL094C expression differs significantly between wild-type and treatment conditions"

  • Multiple testing correction: When assessing expression across numerous conditions, apply appropriate corrections (e.g., Bonferroni, Benjamini-Hochberg) to control false discovery rates

  • Correlation analysis: Calculate correlation coefficients between YBL094C and other genes to identify co-regulated networks, similar to approaches used in the SPELL tool for gene expression profile analysis

  • Statistical power considerations: Ensure sufficient biological and technical replicates (minimum n=3) to detect biologically meaningful expression differences with appropriate statistical power

This comprehensive statistical approach minimizes confounding variables and strengthens the reliability of expression data analysis for poorly characterized genes like YBL094C.

How can researchers effectively design knockout experiments to understand YBL094C function?

Designing effective knockout experiments for YBL094C requires careful consideration of both genetic and phenotypic aspects. Researchers should follow this methodological approach:

First, generate a complete YBL094C deletion strain using homologous recombination with a selectable marker cassette. Verify the deletion through PCR confirmation and sequencing. Then implement these key experimental design elements:

  • Conduct comprehensive phenotypic screening under various growth conditions (different carbon sources, temperatures, stress conditions) to identify conditional phenotypes that might reveal functional roles

  • Employ quantitative growth assays rather than qualitative assessments, measuring growth rates and lag phases across conditions using automated plate readers for increased sensitivity

  • Analyze subcellular structures and processes, particularly focusing on vacuole morphology and endocytic trafficking pathways, as changes in these systems often reveal functional connections for uncharacterized proteins

  • Perform complementation tests with the wild-type YBL094C gene to confirm that observed phenotypes are specifically due to YBL094C deletion

  • Extend the analysis through synthetic genetic array (SGA) screening to identify genetic interactions with other genes, providing insights into functional pathways

  • Integrate knockout data with available proteomic and transcriptomic datasets to place YBL094C in a broader biological context

This systematic approach maximizes the likelihood of detecting subtle phenotypes that provide insights into the biological role of YBL094C, even if no obvious growth defects are initially observed.

What immunological approaches can be used to study YBL094C in recombinant Saccharomyces cerevisiae?

Researchers studying YBL094C can employ several sophisticated immunological approaches leveraging available antibody resources. A comprehensive immunological investigation would include:

First, epitope tagging of endogenous YBL094C with 3xHA, GFP, or TAP tags through homologous recombination to facilitate detection while maintaining native expression regulation. Then implement these specialized techniques:

  • Immunoprecipitation (IP) coupled with mass spectrometry (IP-MS) to identify protein interaction partners of YBL094C, providing insights into its functional network. Use antigen-affinity purified antibodies specifically validated for Saccharomyces cerevisiae strain ATCC 204508/S288c

  • Chromatin immunoprecipitation (ChIP) if YBL094C is suspected to interact with DNA, using appropriate crosslinking conditions optimized for yeast cells

  • Immunofluorescence microscopy with specific antibodies to determine subcellular localization, using appropriate fixation methods that preserve yeast cell wall integrity while allowing antibody penetration

  • Proximity-dependent biotin identification (BioID) by fusing YBL094C to a biotin ligase, allowing identification of proteins in close proximity in living cells

  • Western blotting to analyze YBL094C expression levels across different growth conditions and genetic backgrounds, using validated antibodies at optimized dilutions (typically 1:1000-1:5000)

These approaches can be particularly valuable when combined with genetic manipulations, providing complementary data to elucidate YBL094C's function in cellular processes.

How can researchers effectively express and purify recombinant YBL094C for structural studies?

Expressing and purifying recombinant YBL094C for structural studies requires optimization at multiple steps. The following comprehensive methodology addresses key challenges:

Begin by selecting an appropriate expression system—either E. coli for high yield or yeast for proper eukaryotic post-translational modifications. For yeast expression, consider using the native host S. cerevisiae with strong inducible promoters. The purification workflow should include:

  • Expression vector design:

    • Clone the YBL094C coding sequence into vectors containing affinity tags (His6, GST, or MBP) to facilitate purification

    • Include a precision protease cleavage site for tag removal

    • Consider codon optimization if using heterologous expression systems

  • Expression optimization:

    • Test multiple induction conditions (temperature, inducer concentration, induction time)

    • Screen for solubility by comparing protein distribution between soluble and insoluble fractions

    • Consider co-expression with chaperones if solubility is problematic

  • Purification strategy:

    • Implement a multi-step purification approach beginning with affinity chromatography (utilizing antibodies validated for YBL094C)

    • Follow with size exclusion chromatography to ensure monodispersity

    • Include ion exchange chromatography if higher purity is required for structural studies

    • Verify protein identity via mass spectrometry and Western blotting with specific antibodies

  • Quality control:

    • Assess purity by SDS-PAGE (>95% for crystallography)

    • Confirm proper folding using circular dichroism or thermal shift assays

    • Evaluate homogeneity by dynamic light scattering

This systematic approach maximizes the likelihood of obtaining properly folded, pure YBL094C suitable for downstream structural studies such as X-ray crystallography, cryo-EM, or NMR.

What methodologies are most effective for analyzing YBL094C in whole-cell recombinant yeast systems?

Analyzing YBL094C in whole-cell recombinant yeast systems requires integrative approaches that preserve cellular context while enabling detailed molecular investigation. The most effective methodologies include:

  • Flow cytometry-based approaches:

    • Fusion of YBL094C with fluorescent proteins for quantitative expression analysis at the single-cell level

    • Quantification of cell morphology parameters in YBL094C mutant or overexpression strains

    • Measurement of cellular responses through reporter systems linked to pathways of interest

  • Live-cell imaging techniques:

    • Time-lapse microscopy to track YBL094C-GFP fusion protein dynamics in response to stimuli

    • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility and interactions

    • Multi-color imaging to examine co-localization with organelle markers, particularly vacuolar markers

  • Genomic integration strategies:

    • Precise replacement of the native YBL094C locus with modified versions using CRISPR-Cas9

    • Integration of regulatable promoters to control YBL094C expression levels

    • Construction of recombinant strains expressing YBL094C variants to perform structure-function analyses

  • Phenotypic profiling in whole cells:

    • Systematic growth assays across diverse environmental conditions

    • Chemical genetic screening to identify conditions where YBL094C function becomes essential

    • Metabolomic profiling to detect altered metabolic states in YBL094C mutants

These approaches can be effectively implemented in heat-killed recombinant yeast systems for specific applications, similar to approaches used with other recombinant yeast proteins .

How does YBL094C potentially relate to endocytic protein trafficking pathways?

While YBL094C remains largely uncharacterized, evidence suggests potential involvement in endocytic protein trafficking pathways based on systematic studies of the yeast proteome. Comprehensive overexpression screens examining vacuole morphology have identified novel proteins affecting endocytic trafficking . Although YBL094C was not specifically highlighted among the 53 genes identified in these screens, its putative uncharacterized status makes it a candidate for similar functional roles.

When investigating YBL094C's potential role in endocytic trafficking, researchers should consider:

  • Examining vacuole morphology in YBL094C deletion and overexpression strains using FM4-64 staining and fluorescence microscopy, similar to approaches that identified proteins like Vps3, Vps18, Vps39, and the putative tethering inhibitor Ivy1

  • Analyzing genetic interactions between YBL094C and known endocytic pathway components, particularly ESCRT (Endosomal Sorting Complex Required for Transport) proteins, which showed altered vacuole morphology when overproduced

  • Investigating potential interactions with the AAA-ATPase Vps4, which interacts with Yer128w (renamed Vfa1, Vps Four-Associated 1), as novel protein interactions with this ATPase may indicate involvement in MVB (Multivesicular Body) formation

  • Monitoring protein trafficking using fluorescently tagged cargo proteins known to transit through the endocytic pathway to determine if YBL094C affects their localization or degradation kinetics

This methodical approach can establish whether YBL094C functions within endocytic trafficking pathways, potentially expanding our understanding of this essential cellular process.

What experimental approaches can determine if YBL094C has roles in immunological applications similar to other recombinant Saccharomyces cerevisiae proteins?

To investigate potential immunological applications of YBL094C, researchers should implement a systematic experimental approach that builds upon established work with recombinant yeast proteins:

First, generate recombinant S. cerevisiae strains expressing YBL094C under control of appropriate promoters, ensuring proper protein production. Then follow this experimental pathway:

  • Immunogenicity assessment:

    • Heat-kill the recombinant yeast expressing YBL094C to prepare whole-cell vaccines following protocols established for other yeast-based immunotherapeutics

    • Evaluate immune responses by measuring YBL094C-specific T-cell activation in vitro using techniques such as ELISpot assays, intracellular cytokine staining, and proliferation assays

    • Determine if the recombinant yeast induces robust cellular immunity, as observed with other whole, heat-killed recombinant S. cerevisiae yeast vaccines

  • Safety profile analysis:

    • Conduct dose-escalation studies similar to those performed with other recombinant yeast products like GI-4000

    • Monitor for adverse events while escalating dosage to establish a maximum tolerated dose (MTD)

    • Validate that YBL094C-expressing yeast has a favorable safety profile comparable to other recombinant yeast products

  • Application-specific testing:

    • Evaluate YBL094C-specific immune responses following vaccination, assessing if responses are detectable in approximately 60% of subjects (the benchmark established with other recombinant yeast vaccines)

    • Determine if the protein has any unique immunomodulatory properties that could be leveraged for specific therapeutic applications

This methodical approach will determine if YBL094C shares immunological properties with other recombinant S. cerevisiae proteins that have shown promise in therapeutic applications.

How can high-throughput screening approaches be optimized for studying YBL094C function?

Optimizing high-throughput screening approaches for YBL094C functional analysis requires thoughtful experimental design that balances throughput with biological relevance. Researchers should implement:

  • Phenotypic screening array design:

    • Develop a comprehensive matrix of growth conditions including various carbon sources, nitrogen sources, stress conditions, and chemical perturbagens

    • Implement quantitative growth measurements using automated plate readers with 30-minute time intervals to capture subtle growth phenotypes

    • Analyze data using area under the curve (AUC), maximum growth rate, and lag phase parameters rather than endpoint measurements alone

  • Visual screening optimization:

    • Establish an automated microscopy pipeline examining multiple cellular features simultaneously

    • Focus on vacuole morphology, which has successfully identified novel genes affecting endocytic trafficking in previous screens

    • Implement machine learning algorithms for unbiased image analysis to detect subtle phenotypic changes

  • Genetic interaction profiling:

    • Develop a targeted array of deletion mutants for synthetic genetic interaction testing

    • Prioritize genes involved in endocytic trafficking, stress response, and protein quality control

    • Employ both negative and positive genetic interaction scoring to place YBL094C in functional networks

  • Chemical-genetic profiling:

    • Screen YBL094C deletion strains against libraries of small molecules with known targets

    • Identify compounds with differential effects in wild-type versus YBL094C mutant strains

    • Use these chemical-genetic signatures to infer biological pathways involving YBL094C

This integrated high-throughput approach maximizes the likelihood of identifying conditional phenotypes that reveal YBL094C function, even if standard conditions show no obvious defects.

What are the main challenges in determining gene expression patterns for YBL094C?

Determining gene expression patterns for YBL094C presents several significant challenges that require specialized methodological approaches to overcome. The primary difficulty is evidenced by the absence of expression data in major databases like SGD, which notes "No expression data for YBL094C" . Researchers face these specific challenges:

  • Low abundance expression: YBL094C may be expressed at levels below detection thresholds of standard microarray or RNA-Seq approaches. To address this:

    • Implement targeted RT-qPCR with highly specific primers and increased cycle numbers

    • Use digital PCR for absolute quantification of low-abundance transcripts

    • Apply RNA capture enrichment before sequencing to increase sensitivity for low-expression genes

  • Condition-specific expression: YBL094C may only be expressed under specific environmental conditions not commonly tested. Researchers should:

    • Design comprehensive condition matrices including diverse carbon sources, stress conditions, and developmental stages

    • Perform time-course experiments during key cellular transitions

    • Examine expression during specialized conditions such as sporulation or pseudohyphal growth

  • Technical limitations in detection systems:

    • Standard normalization methods may be unsuitable for genes with unusual expression patterns

    • Probe design for microarrays may be suboptimal for detecting YBL094C

    • Apply log2 transformation and specialized normalization protocols as used in expression analysis tools like SPELL

  • Data integration challenges:

    • Develop correlation analyses with well-characterized genes to identify potential co-regulation patterns

    • Apply specialized tools to compare expression patterns across multiple datasets

    • Integrate proteomics data to confirm transcript-level findings

Addressing these challenges requires a multi-faceted approach combining targeted molecular methods with sophisticated computational analysis.

How should researchers approach contradictory findings in YBL094C functional studies?

When confronting contradictory findings in YBL094C functional studies, researchers should implement a systematic resolution strategy that addresses both technical and biological sources of variation. This methodological approach involves:

  • Standardization of experimental systems:

    • Compare strain backgrounds used across studies (e.g., S288C vs. W303) as genetic background effects can significantly influence phenotypes

    • Standardize growth conditions, media composition, and experimental protocols

    • Develop a consensus set of assays and phenotypic measures to enable direct comparison

  • Rigorous validation of key findings:

    • Independently verify contradictory results using multiple methodological approaches

    • Confirm genetic modifications (deletions, tags) by sequencing to rule out compensatory mutations

    • Perform complementation tests with wild-type YBL094C to confirm phenotype causality

  • Systematic analysis of discrepancies:

    • Construct a comprehensive comparison table documenting methodological differences between studies

    • Investigate dose-dependent effects if YBL094C expression levels differ between studies

    • Consider interaction effects with other genetic or environmental factors

  • Unified experimental design to resolve contradictions:

    • Design factorial experiments specifically addressing the contradictory variables

    • Implement appropriate statistical analyses for interaction effects

    • Apply the principles of experimental design to isolate and control extraneous variables as outlined in research methodology literature

  • Community resource development:

    • Establish repositories for standardized strains and protocols

    • Create publicly accessible databases documenting experimental conditions and outcomes

    • Encourage transparent reporting of negative results to avoid publication bias

This structured approach transforms contradictory findings from obstacles into opportunities for deeper mechanistic understanding of YBL094C function.

What future research directions hold the most promise for characterizing YBL094C function?

Future research directions for YBL094C characterization should leverage emerging technologies while building on established methodological frameworks. The most promising approaches include:

  • Advanced genetic manipulation techniques:

    • Apply CRISPR-Cas9 for precise genomic modifications including point mutations and domain deletions

    • Develop conditional alleles using auxin-inducible degron tags to study essential functions

    • Implement base editing technologies for targeted nucleotide changes without double-strand breaks

  • Integrative multi-omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics data from YBL094C mutants

    • Apply network analysis to position YBL094C within functional pathways

    • Utilize temporal multi-omics to capture dynamic responses to perturbations

  • Structural biology integration:

    • Determine the three-dimensional structure of YBL094C using cryo-electron microscopy or X-ray crystallography

    • Perform structure-guided mutagenesis to test functional hypotheses

    • Utilize computational structural biology to predict protein-protein interaction interfaces

  • Focused investigation of endocytic trafficking:

    • Examine potential interactions with known endocytic regulators, particularly ESCRT components and the AAA-ATPase Vps4

    • Assess vacuole morphology phenotypes in YBL094C mutants under diverse conditions

    • Investigate genetic interactions with established trafficking proteins such as Vps3, Vps18, Vps39, and Ivy1

  • Single-cell approaches:

    • Apply single-cell transcriptomics to capture cell-to-cell variation in YBL094C expression

    • Utilize microfluidics platforms for real-time monitoring of individual cells

    • Develop lineage-tracing experiments to determine if YBL094C function varies across cell division

These forward-looking approaches, combined with rigorous experimental design principles , provide the most promising path toward comprehensive characterization of YBL094C's biological function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.