Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBL100C (YBL100C)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant protein YBL100C is a putative uncharacterized protein derived from Saccharomyces cerevisiae (baker’s yeast), strain S288c. While its precise biological function remains undefined, it is commercially available as a recombinant product for research purposes. This article synthesizes data from genomics, biochemical characterization, and commercial suppliers to provide a detailed profile of YBL100C.

Protein Nomenclature

AttributeValue
Gene NameYBL100C (ORF: YBL0826)
UniProt IDP38168
Molecular WeightNot explicitly reported
Isoelectric PointNot explicitly reported

Gene Context and Regulation

YBL100C is located on chromosome IV (ordered locus name: YBL100C) and is transcribed from nuclear DNA. While no transcriptional regulators or targets are explicitly annotated in the Saccharomyces Genome Database (SGD), its nuclear origin contrasts with mitochondrial-encoded proteins critical for respiratory complexes (e.g., COX1, ATP6) .

Pathway and Interaction Data

Current databases (e.g., SGD, Creative BioMart) lack pathway annotations or protein interaction partners for YBL100C . This reflects the protein’s uncharacterized status, underscoring the need for functional studies.

Potential Use Cases

  • Structural Studies: Recombinant YBL100C enables X-ray crystallography or NMR to elucidate its 3D structure.

  • Functional Screens: High-throughput assays to identify binding partners or enzymatic activity.

  • Comparative Genomics: Phylogenetic analysis to infer evolutionary conservation.

Limitations

  • Functional Ambiguity: No GO annotations (e.g., molecular function, biological process) are assigned in SGD .

  • Experimental Gaps: No published studies validate its role in yeast physiology or disease models.

Table 2: Biochemical Properties

PropertyDescription
Amino Acid SequenceFull-length (1–104 residues)
Post-Translational ModificationsNot reported
StabilityAvoid repeated freeze-thaw cycles

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YBL100C; YBL0826; Putative uncharacterized protein YBL100C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBL100C
Target Protein Sequence
MLFKPKTRAIPSPTARTLPVSFKLASSDTPLILSSKMEETSVGCALVEANLLVEAKAAAA GLAALVELIRVLDRERIAAVRANIIICACFFYLFCYCSCDSYES
Uniprot No.

Target Background

Database Links

STRING: 4932.YBL100C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the current knowledge status of YBL100C in Saccharomyces cerevisiae?

YBL100C belongs to the category of "known unknowns" (KUs) - genomic elements whose sequences are identified but functions remain undetermined . As a putative uncharacterized protein, YBL100C has been identified through genomic sequencing of S. cerevisiae, but lacks functional annotation and experimental validation. Current research approaches combine computational prediction with experimental validation to determine its biological role. The protein represents part of the significant challenge in modern genomics where thousands of sequences have been identified but remain functionally obscure, requiring multiple methodological approaches for characterization .

What expression systems are most effective for studying recombinant YBL100C?

For recombinant expression of putative uncharacterized proteins like YBL100C, homologous expression in S. cerevisiae offers significant advantages over heterologous systems. The pYD1 yeast display vector system has demonstrated particular effectiveness for expressing and displaying proteins on the yeast cell surface . This approach allows the protein to be linked with Aga2 via a (GGGGS)3 linker, which is then anchored to the cell surface through disulfide bonds with Aga1 . Expression optimization typically involves induction with galactose in YNB-CAA medium at 20°C with shaking at 250 rpm for approximately 48 hours, as this timepoint has shown optimal protein expression levels for similar yeast surface display systems .

How can researchers confirm successful expression of YBL100C in recombinant systems?

Verification of successful YBL100C expression requires multiple complementary approaches:

  • Western Blot Analysis: Using anti-YBL100C antibodies to detect the expected molecular weight band (predicted molecular weight plus the fusion partner).

  • Immunofluorescence Assay (IFA): Visualizing the expressed protein on the cell surface using fluorescently labeled antibodies.

  • Flow Cytometry: Quantitatively measuring expression efficiency across the cell population .

The table below outlines the optimal verification methods based on similar protein expression systems in S. cerevisiae:

Verification MethodSample PreparationDetection SystemExpected Results
Western BlotCell lysate, 20 μg/laneAnti-target protein antibodyBand at predicted MW (protein + fusion tag)
ImmunofluorescenceFixed intact cellsFluorescent-labeled antibodySurface fluorescence visible by microscopy
Flow CytometryIntact cells, 1×10⁶ cells/mlFluorescent-labeled antibodyRight-shift in fluorescence histogram compared to control

How does YBL100C expression affect growth kinetics of the host strain?

When expressing recombinant proteins in S. cerevisiae, researchers often question whether the foreign protein expression will negatively impact cell growth. Based on similar systems, expression of recombinant proteins usually results in minimal impact on growth curves. Monitoring both optical density (OD600nm) and colony-forming units (CFU) during expression is recommended to detect any growth impairment . Although slight reductions in growth rates may be observed during logarithmic and stationary phases compared to wild-type strains, these differences typically do not reach statistical significance (P > 0.05) . This suggests that S. cerevisiae can generally tolerate the metabolic burden of expressing uncharacterized proteins without major growth defects.

What are the optimal induction conditions for maximal YBL100C expression?

For optimal expression of recombinant proteins like YBL100C in S. cerevisiae, induction conditions significantly impact protein yield and quality. The expression typically follows time-dependent patterns with maximal expression often observed 48 hours post-induction, followed by a decreasing trend with extended expression times . The recommended induction protocol includes:

  • Grow cells to an OD600nm of approximately 2.0 in glucose-containing medium

  • Centrifuge at 1,500 × g for 2 minutes

  • Resuspend to an OD600nm of 0.5-0.8 in galactose-containing medium

  • Culture at 20°C with shaking at 250 rpm

Quantitative analysis of protein expression at different time points can be performed using Western blotting followed by densitometry with software like ImageJ to determine the optimal harvest time .

What computational approaches can predict the function of YBL100C?

Functional prediction for uncharacterized proteins like YBL100C typically employs multiple computational approaches:

  • Sequence Similarity Analysis: Local sequence similarities can be used to infer function from better-characterized proteins . Tools like BLAST, HMMER, and FASTA are employed to identify distant homologs.

  • Machine Learning Approaches: These methods can predict protein function based on sequence patterns and have demonstrated effectiveness for larger sets of uncharacterized proteins . Support vector machines and neural networks trained on characterized protein datasets can identify functional domains and motifs.

  • Systems Biology Integration: Combining protein-protein interaction data, co-expression analysis, and metabolic pathway mapping provides contextual clues to function .

  • Structural Prediction: Modern structural prediction tools can generate models that suggest binding pockets and potential interaction partners.

The integration of these approaches typically provides more reliable functional predictions than any single method alone, addressing the challenges inherent in annotating putative uncharacterized proteins .

What experimental approaches are most effective for determining YBL100C localization?

To determine the subcellular localization of YBL100C, researchers should employ a multi-method approach:

  • Fluorescent Protein Tagging: Fusion with GFP or other fluorescent proteins, preferably with flexible linkers to minimize interference with protein folding.

  • Immunolocalization: Using antibodies against YBL100C or epitope tags in fixed cells.

  • Subcellular Fractionation: Physical separation of cellular compartments followed by Western blotting.

  • Mass Spectrometry-Based Proteomics: Identification of the protein in purified organelle preparations .

For membrane proteins and surface-displayed constructs, additional techniques such as surface biotinylation or protease accessibility assays may confirm topology. The comprehensive membrane protein characterization approach described for hematopoietic cells provides a useful methodological framework that could be adapted for yeast studies .

How can researchers determine if YBL100C forms protein-protein interactions or complexes?

Identifying protein-protein interactions for uncharacterized proteins requires multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H): Using YBL100C as bait against a prey library of S. cerevisiae proteins.

  • Co-Immunoprecipitation (Co-IP): Pulling down YBL100C and identifying binding partners using mass spectrometry.

  • Proximity Labeling: BioID or APEX2 fusion proteins that biotinylate proximal proteins in vivo.

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics of predicted interactions.

  • Protein Microarrays: Screening YBL100C against arrays of purified proteins.

The data table below outlines the comparative strengths of these techniques:

TechniqueDetection of Transient InteractionsIn vivo/In vitroThroughputTechnical Complexity
Y2HMediumIn vivoHighMedium
Co-IP/MSLowBothMediumHigh
Proximity LabelingHighIn vivoMediumHigh
SPRHighIn vitroLowHigh
Protein MicroarraysMediumIn vitroVery HighHigh

What approaches can resolve structural features of YBL100C?

Structural characterization of uncharacterized proteins presents significant challenges. For YBL100C, researchers should consider:

  • X-ray Crystallography: Requires high-purity, homogeneous protein samples and successful crystallization.

  • Cryo-Electron Microscopy: Particularly valuable for membrane-associated or larger protein complexes.

  • NMR Spectroscopy: For smaller domains or proteins with good solubility.

  • Small-Angle X-ray Scattering (SAXS): Provides information about shape and conformation in solution.

  • Computational Structure Prediction: AlphaFold2 and similar tools have revolutionized structure prediction for proteins without experimental structures.

For surface-displayed constructs, additional techniques such as epitope mapping using deletion mutants or hydrogen-deuterium exchange mass spectrometry can provide valuable structural insights while the protein remains anchored to the cell surface .

How should researchers design experiments to determine if YBL100C is involved in specific cellular processes?

Determining the involvement of uncharacterized proteins in cellular processes requires systematic experimental design:

  • Gene Deletion/Knockdown Studies: Create YBL100C deletion strains and assess phenotypic changes across multiple conditions.

  • Overexpression Studies: Analyze effects of YBL100C overexpression on cell physiology and stress responses.

  • Transcriptomics: RNA-seq comparing wild-type and YBL100C mutant strains to identify affected pathways.

  • Metabolomics: Mass spectrometry-based approaches to identify altered metabolic profiles in YBL100C mutants.

  • Synthetic Genetic Array (SGA) Analysis: Systematic creation of double mutants to identify genetic interactions.

What statistical approaches are most appropriate for analyzing YBL100C characterization data?

Statistical analysis of characterization data for uncharacterized proteins requires rigorous approaches:

  • For Growth Comparisons: t-tests or ANOVA for comparing growth rates between wild-type and recombinant strains expressing YBL100C, with significance thresholds typically set at P < 0.05 .

  • For Expression Optimization: Quantitative analysis of protein expression at different time points using densitometry, with normalization to loading controls .

  • For Functional Assays: Depending on the distribution of data, parametric (t-test, ANOVA) or non-parametric (Mann-Whitney, Kruskal-Wallis) tests should be applied to determine significant differences between experimental groups.

  • For High-Throughput Datasets: False Discovery Rate (FDR) correction for multiple testing, particularly for omics datasets where thousands of comparisons are performed simultaneously.

  • For Machine Learning Predictions: Cross-validation approaches and receiver operating characteristic (ROC) curves to assess the performance of functional prediction algorithms .

Data visualization should follow scientific standards, with appropriate axes labeling, error bars representing standard deviation or standard error, and statistical significance indicators3.

What are the most promising research directions for characterizing YBL100C and similar uncharacterized proteins?

The characterization of putative uncharacterized proteins like YBL100C represents a frontier in functional genomics research. Based on current methodologies and approaches, the most promising research directions include:

  • Integrated Multi-Omics Approaches: Combining proteomics, transcriptomics, and metabolomics data to place YBL100C in its biological context .

  • Machine Learning and AI Applications: Leveraging expanding datasets and improved algorithms for more accurate functional predictions .

  • Evolutionary Analysis: Studying conservation patterns and evolutionary trajectories to infer functional importance.

  • High-Throughput Phenotyping: Systematic testing of mutants under diverse environmental conditions.

  • Structural Biology Integration: Combining experimental and predicted structural data with functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.