Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR027C (YBR027C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YBR027C; YBR0311; Uncharacterized protein YBR027C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR027C
Target Protein Sequence
MFKGSVSLYILCFALGLRNTFLIYNVCNNIKNNCMDNTSGPIGDTIFLIYGIIIIIGPRR CFFFYLKRVVLLQGTHEWCTQGLFPWLKKLEITNVHCHLRRFIICQLHLI
Uniprot No.

Target Background

Database Links

KEGG: sce:YBR027C

STRING: 4932.YBR027C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YBR027C in Saccharomyces cerevisiae and how is it characterized?

YBR027C is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast). Characterization approaches typically involve genomic, proteomic, and bioinformatic methods. The protein is encoded by a 333 bp gene producing a 110 amino acid product . While annotated as "uncharacterized," it is conserved among S. cerevisiae strains, suggesting potential functional importance despite not being essential for cell viability .

To characterize YBR027C, researchers commonly employ:

  • Sequence analysis using bioinformatic tools to identify conserved domains

  • Structural prediction software to determine potential secondary and tertiary structures

  • Protein localization studies using GFP-tagged constructs

  • Expression analysis under various growth conditions

  • Phenotypic analysis of deletion mutants

Characterization efforts should begin with database mining from resources like Saccharomyces Genome Database (SGD), where YBR027C is identified with the systematic name S000000231 .

What are the structural features of YBR027C protein and their research implications?

YBR027C encodes a relatively small protein of 110 amino acids with two predicted transmembrane domains . These structural features provide important insights for research approaches:

Structural FeatureDetailsResearch Implications
Protein length110 amino acidsSuitable for recombinant expression; complete chemical synthesis possible
Transmembrane domains2 predicted TM regionsSuggests membrane localization; special solubilization techniques required for purification
GC content of gene34.23%May influence codon optimization strategies for heterologous expression
Conservation statusConserved among S. cerevisiae strainsFunctional importance despite being non-essential

The presence of transmembrane domains has significant implications for experimental design. When studying membrane proteins, researchers should consider:

  • Using appropriate detergents for solubilization

  • Employing membrane-mimetic environments for functional studies

  • Considering specialized crystallization techniques if structural studies are planned

  • Designing constructs that maintain the integrity of the transmembrane regions

How should researchers approach gene expression studies for YBR027C?

When designing gene expression studies for YBR027C, researchers should implement a systematic experimental approach based on sound experimental design principles . Considering that YBR027C is not an essential gene but is conserved among strains , expression analysis under various conditions may provide insights into its function.

A robust experimental design for YBR027C expression studies should include:

  • Selection of appropriate experimental units and treatments:

    • Define clear treatment groups (e.g., different growth conditions, stress factors)

    • Ensure proper replication across experimental blocks

    • Include necessary controls (wild-type, known-function gene comparisons)

  • Implementation of randomization:

    • Randomly allocate treatments to experimental units within blocks

    • Minimize systematic errors through proper randomization techniques

  • Statistical power considerations:

    • Determine appropriate sample sizes based on expected effect sizes

    • Plan for sufficient biological and technical replicates

For quantitative expression analysis, researchers should consider:

  • RT-qPCR with carefully selected reference genes

  • RNA-seq for genome-wide context

  • Protein-level confirmation through Western blotting or mass spectrometry

The data analysis should account for variability among blocks (e.g., different batches of yeast cultures) through appropriate statistical methods such as randomized block design ANOVA .

What are the fundamental approaches to functionally characterize an uncharacterized protein like YBR027C?

Functional characterization of uncharacterized proteins like YBR027C requires a multi-faceted approach combining computational predictions with experimental validation. The methodological framework should include:

  • Computational analysis:

    • Sequence homology searches against characterized proteins

    • Protein domain prediction and functional inference

    • Structural modeling to predict potential binding sites

    • Integration with -omics datasets to identify potential functional associations

  • Experimental characterization:

    • Generation of deletion and overexpression strains

    • Phenotypic profiling under various conditions

    • Protein-protein interaction studies (e.g., yeast two-hybrid, co-immunoprecipitation)

    • Subcellular localization determination

  • Biochemical characterization:

    • Expression and purification of recombinant protein

    • In vitro activity assays based on predicted functions

    • Structural studies if appropriate

For membrane proteins with transmembrane domains like YBR027C , specialized approaches may be necessary, including membrane-mimetic environments for functional assays and careful consideration of protein topology when designing tagged constructs.

The experimental design should incorporate proper controls, randomization, and replication as outlined in fundamental experimental design principles , with particular attention to potential variability sources specific to membrane protein studies.

How can researchers effectively design experiments to elucidate the function of YBR027C's transmembrane domains?

The presence of two transmembrane domains in YBR027C presents specific challenges and opportunities for functional characterization. An advanced experimental approach should consider the topological arrangement of these domains and their potential roles in protein function:

  • Membrane topology mapping:

    • Implement reporter fusion approaches (e.g., PhoA/GFP dual reporters)

    • Perform protease protection assays with membrane-impermeable proteases

    • Use glycosylation site insertion to determine lumenal/cytosolic orientation

  • Functional significance assessment:

    • Design domain-swapping experiments with characterized membrane proteins

    • Perform systematic mutagenesis of conserved residues within transmembrane domains

    • Assess impact on protein stability, localization, and potential interacting partners

  • Experimental design considerations:

    • Implement a randomized block design to control for experimental variability

    • Ensure treatment factors (e.g., mutations, conditions) are randomly assigned within blocks

    • Include appropriate replication to detect potentially subtle phenotypic effects

Experimental ApproachMethodologyControls Required
Topology mappingReporter fusions at predicted loop regionsPositive controls with known topology; negative controls with cytosolic proteins
MutagenesisSite-directed changes to conserved residuesWild-type protein; mutations in non-conserved regions
Interaction studiesSplit-ubiquitin membrane yeast two-hybridSelf-activation controls; specificity controls with unrelated membrane proteins
Functional complementationExpression in related yeasts lacking orthologous genesEmpty vector; expression of known functional homologs

The analysis should incorporate appropriate statistical methods for a randomized block design , with careful attention to potential confounding factors specific to membrane protein experiments.

What approaches can resolve contradictory results in YBR027C functional studies?

When encountering contradictory results in YBR027C functional studies, researchers should implement a systematic troubleshooting and validation framework:

  • Experimental design review:

    • Evaluate whether the experimental design adequately controlled for confounding variables

    • Assess if randomization was properly implemented across experimental blocks

    • Review whether replication was sufficient to detect true effects

  • Methodological validation:

    • Cross-validate results using orthogonal techniques

    • Implement positive and negative controls to ensure assay functionality

    • Consider strain background effects and genetic interactions

  • Resolution strategies:

    • Conduct meta-analysis of multiple independent experiments

    • Design decisive experiments specifically addressing the contradiction

    • Consider environmental or contextual factors that might explain discrepancies

  • Statistical approach:

    • Apply appropriate statistical tests for the experimental design used

    • Consider Bayesian approaches to incorporate prior knowledge

    • Perform sensitivity analyses to identify potential sources of variability

For transmembrane proteins like YBR027C , additional considerations include membrane extraction conditions, expression levels, and potential artifacts from tagging or overexpression. The non-essential nature of YBR027C may also contribute to contextual functionality that manifests only under specific conditions, requiring careful experimental design to detect.

What are the implications of YBR027C being non-essential but conserved, and how should this inform research approaches?

The apparently contradictory status of YBR027C as non-essential yet conserved across S. cerevisiae strains presents an interesting research question that should inform experimental approaches:

  • Evolutionary and functional significance:

    • Conservation despite dispensability suggests condition-specific functions

    • Potential redundancy with other genes/proteins

    • Possible subtle phenotypes that provide selective advantage in natural environments

  • Experimental approach considerations:

    • Design experiments to test function under diverse stress conditions

    • Implement synthetic genetic array analysis to identify genetic interactions

    • Consider creating multiple mutants to address potential redundancy

  • Experimental design implementation:

    • Use randomized block design to control for environmental variability

    • Ensure sufficient replication to detect subtle phenotypic effects

    • Apply factorial designs to test interactions between conditions and genetic backgrounds

Research ImplicationExperimental ApproachDesign Consideration
Condition-specific functionGrowth/phenotypic assays under diverse stressesRandomized block design with condition as treatment factor
Genetic redundancyDouble/triple mutant construction with related genesFactorial design to detect genetic interactions
Subtle fitness contributionCompetition assays with wild-type strainTime-series sampling with sufficient replication
Environmental adaptationTesting in natural-like conditionsBlock design controlling for media/condition variability

Statistical analysis should be carefully designed to detect potentially subtle effects, with consideration of appropriate multiple testing corrections and sensitivity analyses . The non-essential nature of YBR027C suggests that traditional knockout phenotyping may be insufficient, requiring more sensitive or condition-specific assays.

How should bioinformatic approaches be integrated with experimental methods for YBR027C characterization?

Effective characterization of uncharacterized proteins like YBR027C requires seamless integration of bioinformatic predictions with experimental validation in an iterative process:

  • Initial bioinformatic characterization:

    • Sequence analysis for conserved motifs and domains

    • Structural prediction with special attention to transmembrane domains

    • Phylogenetic analysis across yeast species

    • Integration with existing -omics datasets

  • Hypothesis generation and experimental design:

    • Develop testable hypotheses based on bioinformatic predictions

    • Design experiments with appropriate controls and replication

    • Implement randomized block designs to control for experimental variability

  • Data integration and refinement:

    • Feed experimental results back into bioinformatic models

    • Refine predictions based on experimental outcomes

    • Develop integrated functional models

Bioinformatic ApproachOutputExperimental Validation Method
Transmembrane predictionTwo predicted TM domains Biochemical topology mapping; fluorescence microscopy
Structural homology modelingPredicted 3D structureMutational analysis of key residues; structural studies
Protein-protein interaction predictionPotential interacting partnersCo-immunoprecipitation; yeast two-hybrid assays
Expression correlation analysisCo-expressed genesRT-qPCR validation; functional clustering analysis

The analysis of experimental results should incorporate appropriate statistical methods based on the experimental design implemented , with particular attention to controlling for biological variability in yeast cultures and potential technical biases in both computational and experimental approaches.

How should researchers design experiments to study the cellular localization of YBR027C?

Determining the cellular localization of a transmembrane protein like YBR027C requires careful experimental design to avoid artifacts while generating reliable data:

  • Experimental approach selection:

    • Fluorescent protein tagging (e.g., GFP, mCherry)

    • Immunofluorescence with specific antibodies

    • Subcellular fractionation followed by Western blotting

    • Proximity-based labeling approaches (BioID, APEX)

  • Experimental design considerations:

    • Implement randomized complete block design to control for batch effects

    • Include multiple biological replicates across independent experiments

    • Randomly assign treatments within experimental blocks

  • Control implementation:

    • Include known markers for cellular compartments

    • Use both N- and C-terminal tagging approaches to control for topology effects

    • Include untagged controls and markers for membrane compartments

Experimental ApproachControls RequiredPotential PitfallsStatistical Analysis
GFP fusion microscopyKnown membrane protein markers; untagged strainTag interference with localization; autofluorescenceQuantitative colocalization analysis
Subcellular fractionationCompartment-specific marker proteinsIncomplete separation; contaminationWestern blot quantification with normalization
ImmunofluorescencePrimary antibody specificity controls; secondary only controlsFixation artifacts; nonspecific bindingSignal-to-noise quantification
Proximity labelingCompartment-specific controls; expression level controlsBiotinylation efficiency; background labelingEnrichment analysis versus controls

For transmembrane proteins like YBR027C , specific considerations include:

  • Potential mislocalization due to overexpression

  • Tag interference with membrane insertion or topology

  • Need for membrane permeabilization during immunostaining

The statistical analysis should account for the experimental design used, with appropriate methods for randomized block designs and consideration of technical and biological variability sources .

What randomized block design strategies are most appropriate for YBR027C expression studies?

When studying the expression of YBR027C, implementing a proper randomized block design is essential to control for sources of variability while maximizing statistical power:

  • Block identification and implementation:

    • Identify potential sources of heterogeneity (e.g., yeast batch, day of experiment, growth chamber)

    • Group experimental units into homogeneous blocks based on these factors

    • Randomly assign treatments within each block to maintain independence

  • Treatment factor considerations:

    • Define clear treatment factors (e.g., growth conditions, genetic backgrounds)

    • Ensure balanced representation across blocks when possible

    • Consider factorial designs for multiple treatment factors

  • Replication strategy:

    • Implement both biological and technical replication

    • Ensure sufficient replication for detecting expected effect sizes

    • Balance replication needs with experimental resources

Block Factor ExampleImplementation MethodStatistical Consideration
Batch of yeast cultureUse same batch for all treatments within blockInclude block as factor in ANOVA model
Day of experimentPerform complete block of treatments each dayTest for block-treatment interaction
Microplate positionDistribute treatments randomly within plateControl for position effects in analysis
ExperimenterEach experimenter processes complete blocksInclude experimenter as random effect

The statistical analysis should follow the principles outlined for randomized block designs :

  • Include block effects in the statistical model

  • Test for treatment effects after accounting for block variability

  • Consider potential block-treatment interactions

For YBR027C expression studies specifically, additional considerations include:

  • Controlling for cell density and growth phase effects

  • Normalizing expression data appropriately (especially important for membrane proteins)

  • Considering the impact of the two transmembrane domains on expression detection methods

How can researchers optimize recombinant expression systems for the study of YBR027C?

Optimizing recombinant expression of transmembrane proteins like YBR027C presents specific challenges that require careful experimental design:

  • Expression system selection:

    • Homologous expression in S. cerevisiae

    • Heterologous expression in E. coli, insect cells, or mammalian cells

    • Cell-free expression systems with membrane mimetics

  • Construct design considerations:

    • Codon optimization based on GC content (34.23%) and host preference

    • Fusion tags selection (affinity, solubility, detection)

    • Signal sequence and topology preservation

    • Promoter strength and induction control

  • Experimental design implementation:

    • Randomized block design to control for batch effects

    • Factorial design to optimize multiple parameters simultaneously

    • Sufficient replication to reliably detect expression differences

Expression ParameterOptimization ApproachExperimental Design
Host strain selectionScreen multiple strains systematicallyRandomized complete block design
Induction conditionsTest temperature, inducer concentration, timeFactorial design with blocking by batch
Fusion tag positionCompare N-terminal, C-terminal, and internal tagsCompletely randomized design with multiple replicates
Membrane extractionTest detergent panel and solubilization conditionsRandomized block design with protein batch as block

Statistical analysis should:

  • Account for the experimental design structure

  • Implement appropriate transformations for non-normal data

  • Consider interactions between optimization parameters

  • Use response surface methodology for complex optimization problems

For YBR027C specifically, the presence of two transmembrane domains necessitates careful consideration of membrane integration, protein folding, and extraction conditions, which should be systematically optimized using appropriate experimental design principles.

What controls and validation methods are essential when performing genetic modification of YBR027C?

When genetically modifying YBR027C for functional studies, implementing appropriate controls and validation steps is crucial for generating reliable and interpretable data:

  • Modification strategy validation:

    • PCR verification of correct integration/modification

    • Sequencing confirmation of the modified locus

    • Expression verification (mRNA and protein levels)

    • Phenotypic comparison with published data for known modifications

  • Essential experimental controls:

    • Wild-type unmodified strain processed in parallel

    • Empty vector controls for plasmid-based studies

    • Control modifications to unrelated genes with known outcomes

    • Complementation with wild-type gene to confirm phenotype specificity

  • Experimental design implementation:

    • Randomized complete block design to control for batch effects

    • Include biological replicates across independent transformations

    • Control for position effects with multiple integration sites when relevant

Modification TypeValidation MethodEssential ControlsStatistical Consideration
Gene deletionPCR verification; sequencing of junctionsWild-type; complementation strainCompare multiple independent deletion clones
Epitope taggingWestern blot; immunoprecipitationUntagged strain; alternative tag positionBlock by protein preparation batch
Point mutationsSequencing; expression verificationWild-type; conservative mutationsMultiple independent mutant clones as replicates
Promoter replacementRT-qPCR; reporter assaysNative promoter; constitutive controlNormalization to reference genes

For YBR027C specifically, considerations should include:

  • Verification that modifications don't disrupt the transmembrane domains

  • Confirmation of proper membrane integration for the modified protein

  • Validation of subcellular localization for the modified protein

  • Assessment of potential effects on interacting partners

Statistical analysis should account for the experimental design implemented , with appropriate consideration of technical and biological sources of variation.

What statistical approaches are most appropriate for analyzing YBR027C expression data?

Analyzing expression data for YBR027C requires statistical approaches that account for the experimental design while addressing specific challenges of membrane protein expression analysis:

  • Statistical model selection:

    • For randomized block designs, use ANOVA with block effects

    • For time-series data, consider repeated measures ANOVA or mixed models

    • For complex designs, implement generalized linear models with appropriate error structures

  • Data preprocessing considerations:

    • Normality assessment and appropriate transformations

    • Outlier identification and handling

    • Normalization approaches for expression data (global vs. targeted)

  • Statistical analysis implementation:

    • Account for experimental design structure in the model

    • Include appropriate random and fixed effects

    • Implement post-hoc tests with proper multiple testing correction

Data TypeStatistical ApproachDesign ConsiderationVisualization Method
RT-qPCRΔΔCt method with reference gene normalizationBlock by PCR run and RNA extraction batch Relative expression bar plots with error bars
RNA-seqDESeq2 or edgeR analysisAccount for batch effects; include blocking factors MA plots; heatmaps; volcano plots
Protein quantificationANOVA on normalized Western blot dataBlock by protein preparation batch Bar plots with individual data points
ProteomicsLinear models with empirical Bayes statisticsMass spec batch as blocking factor Protein abundance heatmaps; interaction networks

For YBR027C specifically, additional considerations include:

  • Accounting for membrane fraction enrichment variability

  • Normalization against appropriate membrane protein controls

  • Consideration of the non-essential nature of the gene when interpreting expression changes

The statistical analysis should provide not just significance values but also effect sizes, confidence intervals, and appropriate visualizations to facilitate interpretation .

How should researchers integrate multiple data types when studying YBR027C function?

Integrating multiple data types for functional characterization of YBR027C requires systematic approaches that maintain statistical rigor while extracting biological insights:

Data Type CombinationIntegration MethodStatistical ApproachVisualization
Transcriptomics + ProteomicsCorrelation analysis; pathway enrichmentMultivariate methods; enrichment statisticsIntegrated heatmaps; pathway diagrams
Localization + Interaction dataSpatial interaction networksGraph-based statistics; enrichment analysisSubcellular network maps
Phenotype + ExpressionRegression modeling; decision treesMultivariate regression; classification metricsDecision boundaries; feature importance plots
Evolutionary + Functional dataPhylogenetic profiling; homology mappingPhylogenetic comparative methodsAnnotated phylogenetic trees; conservation plots

For YBR027C specifically, integration should consider:

  • Membrane localization information from the two transmembrane domains

  • Condition-specific functionality suggested by its non-essential but conserved nature

  • Potential interaction partners in membrane compartments

  • Evolutionary patterns across yeast species

The statistical analysis should account for different noise levels and confidence in various data types, with appropriate uncertainty propagation throughout the integration process.

What approaches can identify potential functions of YBR027C based on genetic interaction networks?

Genetic interaction analysis can provide crucial insights into the function of uncharacterized proteins like YBR027C by placing them in a functional context:

  • Systematic genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis with YBR027C deletion

    • Quantitative analysis of genetic interactions under multiple conditions

    • Comparison with known interaction networks of characterized genes

  • Network analysis approaches:

    • Functional module identification through clustering

    • Pathway enrichment of interacting genes

    • Network topology analysis to identify functional hubs and bottlenecks

  • Experimental design considerations:

    • Implement randomized block design for SGA screens

    • Include appropriate controls (known interactors, non-interactors)

    • Ensure sufficient replication for reliable interaction scoring

Analysis ApproachMethodologyStatistical ConsiderationsOutput Format
Global genetic interaction mappingSGA or E-MAP with YBR027C deletionScore normalization; significance testingInteraction score matrix; network visualization
Condition-specific interactionsComparative interaction analysis across conditionsDifferential interaction analysisCondition-specific network changes
Suppressor/enhancer screeningSelection-based identification of genetic interactorsEnrichment analysis; selection bias correctionRanked list of modifiers with interaction strengths
Chemical-genetic profilingDrug sensitivity profiling of YBR027C mutantsMultidimensional scaling; clusteringChemical-genetic interaction maps

For YBR027C specifically, genetic interaction analysis should consider:

  • Potential membrane-related functions implied by the transmembrane domains

  • Contextual importance suggested by its non-essential but conserved nature

  • Potential redundancy with other genes explaining the lack of essentiality

The statistical analysis should implement appropriate normalization methods for interaction scores, multiple testing correction, and consideration of network structure in significance assessment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.