Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR051W (YBR051W)

Shipped with Ice Packs
In Stock

Description

Overview and Basic Characteristics

The YBR051W protein is encoded by a gene located on chromosome II of Saccharomyces cerevisiae, one of the most extensively studied eukaryotic model organisms. As indicated by its name, YBR051W (where "Y" denotes yeast, "B" indicates chromosome II, "R" signifies the right arm of the chromosome, and "051W" represents its specific locus) remains functionally uncharacterized despite being identified through genomic sequencing efforts . The full-length protein consists of 116 amino acids and has been assigned the UniProt accession number P38233 . Alternative designations include YBR0504A, though YBR051W remains the primary identifier in scientific literature .

The recombinant form of this protein has been produced for research purposes, typically with affinity tags such as histidine (His) tags to facilitate purification and study. Despite limited functional characterization, the availability of recombinant YBR051W provides researchers with opportunities to investigate its properties and potential roles in cellular processes.

Physicochemical Properties

Based on its amino acid composition, YBR051W appears to be a hydrophobic protein with multiple transmembrane regions, suggesting it may be membrane-associated. The prevalence of hydrophobic amino acids (such as leucine, isoleucine, and phenylalanine) in the sequence supports this hypothesis. The protein contains several phenylalanine residues, which contribute to its hydrophobic character and may play roles in protein folding and stability.

Expression Systems

The recombinant form of YBR051W has been successfully expressed in Escherichia coli as documented in commercial protein catalogs . This heterologous expression system allows for the production of sufficient quantities of the protein for research applications. The expression of yeast proteins in bacterial systems represents a common approach for obtaining purified proteins while overcoming challenges associated with extracting proteins directly from yeast cells.

Protein Tags and Modifications

Commercially available recombinant YBR051W is typically produced with an N-terminal histidine (His) tag . This affinity tag serves multiple purposes:

  1. Facilitates purification through immobilized metal affinity chromatography

  2. Enables detection via antibodies against the His tag

  3. May improve protein solubility in some cases

The addition of such tags must be considered when interpreting experimental results, as they may influence protein structure or function.

Purification and Quality Control

According to product specifications, recombinant YBR051W is typically purified to greater than 90% purity as determined by SDS-PAGE analysis . This level of purity is essential for research applications requiring minimal contamination with host cell proteins or other impurities. The purified protein is generally supplied as a lyophilized powder, requiring reconstitution before use .

Buffer Composition

The recombinant protein is typically supplied in a Tris-based buffer containing 50% glycerol, with pH maintained at approximately 8.0 . This buffer composition helps stabilize the protein during storage and prevents degradation. Some suppliers include additional stabilizers such as 6% trehalose .

Reconstitution and Handling

When working with lyophilized preparations, it is recommended to briefly centrifuge the vial before opening to ensure the powder is at the bottom. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . To prevent protein degradation during freeze-thaw cycles, it is advisable to add glycerol (to a final concentration of 5-50%) before aliquoting for long-term storage . Repeated freezing and thawing are not recommended as they may lead to protein denaturation and loss of activity .

Chromosomal Location and Genomic Environment

YBR051W is located on chromosome II of Saccharomyces cerevisiae. Interestingly, research on synthetic yeast chromosomes identified a 13 kb inversion containing seven genes, including YBR051W, YBR050C, YBR052C, YBR053C, YBR054W, YBR055C, and YBR056W . This genomic rearrangement was observed during SCRaMbLE (Synthetic Chromosome Rearrangement and Modification by LoxP-mediated Evolution) experiments, suggesting that this region might be subject to structural variations that could influence cellular phenotypes.

Relation to Neighboring Genes

The genomic neighborhood of YBR051W includes other genes of interest, such as YBR056W-A (also known as MNC1), which has been characterized as a putative membrane protein upregulated in response to toxic manganese levels . While direct functional relationships between YBR051W and neighboring genes have not been definitively established, the proximity and potential co-regulation suggest possible functional connections.

Predicted Functional Domains

Although definitive functional characterization of YBR051W is lacking, analysis of its sequence and comparison with related proteins may provide clues about its potential roles. The predominantly hydrophobic nature of its amino acid sequence suggests possible membrane association, which could indicate involvement in membrane transport, signaling, or structural functions.

Expression Patterns

While specific information about the expression patterns of YBR051W is limited in the provided search results, studies of neighboring genes such as YBR056W-A (MNC1) have shown stress-responsive expression, particularly in response to heavy metal ions . This contextual information suggests that YBR051W might also be regulated in response to specific environmental conditions, though direct evidence is not available in the search results.

Tools for Functional Genomics

Recombinant YBR051W serves as a valuable tool for functional genomics studies, enabling researchers to investigate protein-protein interactions, subcellular localization, and biochemical properties. Such studies contribute to the broader understanding of the Saccharomyces cerevisiae proteome and help annotate previously uncharacterized genes.

Antibody Production and Detection

The availability of purified recombinant YBR051W facilitates the production of specific antibodies, which can be used for various immunological applications, including Western blotting, immunoprecipitation, and immunohistochemistry. These techniques enable the detection and localization of the native protein in yeast cells, potentially revealing insights about its biological function.

Functional Characterization Strategies

To better understand the biological role of YBR051W, several approaches could be pursued:

  1. Gene knockout or knockdown studies to observe phenotypic effects

  2. Protein localization studies using fluorescent tags

  3. Identification of interaction partners through co-immunoprecipitation or yeast two-hybrid screens

  4. Expression profiling under various stress conditions to identify regulatory patterns

  5. Comparative genomics across fungal species to identify evolutionary conservation and divergence

Potential Clinical and Biotechnological Applications

While the immediate applications of YBR051W research may be primarily academic, advances in understanding yeast proteins often translate to broader biotechnological and medical applications. Saccharomyces cerevisiae serves as an important model organism and biotechnological tool, and characterizing its proteome contributes to the development of improved yeast strains for various applications, from biofuel production to pharmaceutical manufacturing.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own adjustments.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
YBR051W; YBR0504A; Putative uncharacterized protein YBR051W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR051W
Target Protein Sequence
MHILFLFIFHCLAFKDLIFFKQYVPFAAAGGYPISFLFIKVLTASTNLLLSSSSGGSWNK LSKESQLLKVILTHFLVPIFFFLFQYIILSEDRQQERQPKFRDNAKFDGHAKTCHI
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the YBR051W gene and its protein product?

YBR051W is a gene located in the Saccharomyces cerevisiae genome encoding a putative uncharacterized protein. The gene is found in the reference genome sequence derived from laboratory strain S288C. As an uncharacterized protein, its precise function remains to be elucidated through experimental investigation. Current information is maintained in the Saccharomyces Genome Database (SGD), which provides sequence data, GO annotations, phenotype information, and molecular characteristics. The database offers basic sequence-derived properties such as length, molecular weight, and isoelectric point, as well as experimentally determined information about median abundance and median absolute deviation . Understanding this protein begins with accessing these fundamental data points before designing targeted experimental approaches.

What tools and resources are available for initial YBR051W characterization?

The Saccharomyces Genome Database provides several essential tools for studying YBR051W. Researchers can access BLASTN and BLASTP tools for nucleotide and protein sequence comparisons, respectively, including specialized versions for comparison against fungal genomes . Additional bioinformatic resources include primer design tools, restriction fragment mapping, six-frame translation, and access to GO annotations. Experimental resources include information about phenotypes of mutant strains and protein information such as abundance measurements. A methodological approach to utilizing these resources would involve first conducting sequence analysis to identify conserved domains, followed by comparative genomics to find homologs in related species, and finally designing functional genomics experiments based on computational predictions and available phenotypic data.

How should I design a basic experiment to begin functional characterization of YBR051W?

To begin characterizing an uncharacterized protein like YBR051W, a systematic experimental approach is essential. Starting with gene deletion or knockout experiments allows observation of resulting phenotypes that might indicate function. The experimental design should follow principles of a Completely Randomized Design (CRD) where treatments (wild-type and deletion strains) are randomly allocated to experimental units without any blocking . This design is appropriate when the experimental material is homogeneous, such as when working with a single yeast strain background. For each experiment, ensure inclusion of appropriate controls (e.g., wild-type strain, empty vector), sufficient replication (at least 3-5 biological replicates), and randomization of sample processing to minimize systematic errors . The phenotypic analysis should examine growth under various conditions, morphology, and specific cellular processes based on predictions from sequence analysis or gene expression patterns.

What experimental design is most appropriate for studying phenotypes associated with YBR051W mutations under various environmental conditions?

When studying phenotypes associated with YBR051W mutations under various environmental conditions, a Randomized Complete Block Design (RCBD) is most appropriate. The RCBD is suitable when experimental units can be grouped into blocks where units within a block are relatively homogeneous . In this approach, each environmental condition represents a treatment, and each experimental run or plate represents a block. Within each block, all treatments (wild-type and various YBR051W mutants) are randomly assigned to experimental units. This design effectively controls for variation between experimental batches or plates that might otherwise mask treatment effects . The statistical analysis would involve a two-way ANOVA accounting for both treatment effects and block effects. The model would follow: yij = μ + τi + βj + εij, where τi represents the treatment effect, βj represents the block effect, and εij represents the error term . This approach significantly reduces experimental error compared to a completely randomized design when working across multiple conditions or time points.

How can I design experiments to investigate genetic interactions involving YBR051W?

Investigating genetic interactions involving YBR051W requires systematic experimental approaches that control for variability while testing multiple gene combinations. A Latin Square Design would be particularly effective for this purpose, especially when testing interactions with a modest number of genes (e.g., 4-7 genes) . In this design, each gene deletion is combined with the YBR051W deletion in a structured pattern that controls for potential position effects or temporal variations during experimentation. For instance, with a 4×4 Latin Square, four different gene deletions would be tested in combination with YBR051W deletion across four different experimental conditions or time points, with each combination appearing exactly once in each row and column . This design provides excellent statistical power while controlling for two potential sources of variation. For larger-scale genetic interaction screening, a modified approach using Completely Randomized Design with appropriate controls and replication would be necessary. The analysis would involve ANOVA testing for interaction effects between YBR051W and the tested genes, with particular attention to epistatic relationships that might indicate pathway connections or functional relationships.

What statistical considerations are essential when analyzing differential expression of YBR051W under various experimental conditions?

When analyzing differential expression of YBR051W under various experimental conditions, several statistical considerations are essential for robust analysis. First, the experimental design should incorporate sufficient biological replicates (minimum 3-4) and appropriate blocking structures to account for batch effects . If testing multiple factors simultaneously (e.g., temperature, media composition, genetic background), a factorial design allows assessment of both main effects and interactions . For the statistical analysis itself, it's important to first assess data normality and perform appropriate transformations if necessary. When analyzing RNA-seq or microarray data, specialized statistical methods that account for the specific error structure of these technologies must be employed. Importantly, all analyses must incorporate multiple testing correction (e.g., Benjamini-Hochberg procedure) to control the false discovery rate when examining expression across multiple conditions. Power analysis should be conducted prior to experimentation to ensure sufficient sample size for detecting biologically meaningful expression differences. Finally, validation of interesting expression patterns using orthogonal methods like qRT-PCR should be performed following a similar experimental design strategy.

How can I integrate proteomics and transcriptomics data to develop a comprehensive model of YBR051W function?

Integrating proteomics and transcriptomics data to develop a comprehensive model of YBR051W function requires careful experimental design and sophisticated data analysis approaches. The experimental design should ensure matched samples for both data types, with consistent conditions, time points, and strain backgrounds. A randomized block design is recommended to control for batch effects across platforms . For the integration analysis, several approaches are valuable: correlation analysis between transcript and protein levels of YBR051W across conditions; network analysis incorporating YBR051W expression with its potential interactors; and pathway enrichment analysis examining both transcriptional and proteomic responses to YBR051W perturbation. The integration should account for the different dynamic ranges and temporal characteristics of transcriptomic versus proteomic data. Time-course experiments are particularly valuable, as they can reveal regulatory relationships through temporal patterns. Statistical integration might employ multivariate methods such as canonical correlation analysis or partial least squares regression to identify coordinated changes across data types. The resulting model should generate testable hypotheses about YBR051W function that can be validated through targeted genetic and biochemical experiments.

What approaches should be used to resolve contradictory results about YBR051W function from different experimental approaches?

Resolving contradictory results about YBR051W function requires systematic meta-analysis and targeted follow-up experiments. The contradictions may arise from differences in strain backgrounds, experimental conditions, or methodological approaches. A structured approach to resolution begins with careful examination of experimental designs in contradictory studies, identifying potential sources of variation . Next, design experiments that specifically address the contradictions, using appropriate randomization and blocking to control for known sources of variation . For instance, if results differ between growth-based and biochemical assays, a Latin Square Design could test both approaches under identical conditions while controlling for temporal and spatial variation . Include positive and negative controls relevant to each contradictory finding, and consider testing across multiple strain backgrounds to assess genetic context effects. Statistical analysis should employ models that can incorporate data from multiple experimental approaches, such as mixed-effects models that account for different error structures across methods. Finally, consider designing experiments that can distinguish between competing hypotheses, rather than simply repeating previous approaches. This systematic approach transforms contradictions into opportunities for deeper understanding of contextual factors affecting YBR051W function.

How can I design experiments to identify and validate the subcellular localization of YBR051W under different physiological conditions?

Designing experiments to identify and validate the subcellular localization of YBR051W under different physiological conditions requires a multi-faceted approach. First, create fluorescent protein fusions (e.g., GFP-YBR051W) at both N- and C-termini to account for potential interference with localization signals. Validate functionality of these fusions by complementation tests in a YBR051W deletion strain. For experimental design, a Randomized Complete Block Design is appropriate, with each physiological condition (e.g., different carbon sources, stress conditions, cell cycle stages) as a treatment and experimental day as a block . This controls for day-to-day variations in microscopy settings or cell preparation. Include both positive controls (proteins with known localization patterns) and negative controls (unfused fluorescent protein) in each experimental block. Quantitative image analysis should measure co-localization with organelle markers across at least 100 cells per condition. To validate microscopy results, perform biochemical fractionation experiments following a similar experimental design, where cellular fractions are isolated and analyzed for YBR051W presence by Western blotting. Statistical analysis should employ both categorical assessments of primary localization and quantitative measures of distribution across compartments, analyzed using appropriate ANOVA models that account for the blocking structure .

What are the optimal conditions for expressing and purifying recombinant YBR051W for biochemical studies?

Optimizing expression and purification of recombinant YBR051W requires systematic testing of expression systems and conditions. A factorial experimental design is ideal for this optimization process, allowing for efficient testing of multiple variables . Key factors to test include: expression host (E. coli, S. cerevisiae, Pichia pastoris), vector type (affecting fusion tags and expression levels), induction conditions (temperature, inducer concentration, duration), and cell lysis and purification methods. Within each host system, design experiments that test combinations of these factors using a randomized block design, where each experimental run forms a block . For example, when testing expression temperature (15°C, 25°C, 30°C) and induction duration (4h, 8h, overnight) in E. coli, create a 3×3 factorial design with appropriate replication. Protein yield and purity should be quantitatively assessed for each condition, and the resulting data analyzed using ANOVA to identify significant factors and interactions . Once initial conditions are identified, a response surface methodology approach can further optimize critical parameters. The purification strategy should similarly be optimized through systematic testing of buffer compositions, purification methods, and storage conditions. This comprehensive experimental design approach ensures identification of conditions that maximize both yield and activity of the recombinant YBR051W protein.

How should I design CRISPR-Cas9 experiments to study YBR051W function in S. cerevisiae?

Designing CRISPR-Cas9 experiments to study YBR051W requires careful consideration of targeting strategy, experimental controls, and validation methods. First, design multiple guide RNAs targeting different regions of YBR051W using established design tools that maximize on-target efficiency while minimizing off-target effects. For experimental design, employ a Completely Randomized Design where each gRNA construct is randomly assigned to experimental units (yeast transformation reactions) . Include appropriate controls: non-targeting gRNA, gRNA targeting a non-essential gene with known phenotype, and wild-type cells without CRISPR components. For each gRNA and control, perform at least 3-5 biological replicates. The editing strategy should be chosen based on the research question: complete knockout for loss-of-function studies, point mutations for structure-function analysis, or promoter modifications for expression studies. After transformation and selection, validate editing through PCR and sequencing of the target locus. For functional assessment, design experiments following Randomized Complete Block Design principles, with each experimental run as a block, testing edited strains alongside controls under conditions relevant to hypothesized YBR051W function . Statistical analysis should account for potential clonal effects by testing multiple independently derived clones for each edit. This systematic approach ensures robust genetic modification while controlling for experimental variables that could confound interpretation of YBR051W function.

What high-throughput screening methods are appropriate for identifying potential functions of YBR051W?

High-throughput screening to identify potential functions of YBR051W requires carefully designed experimental approaches that balance breadth of coverage with statistical power. A systematic phenotypic screening approach using a YBR051W deletion strain should test growth under hundreds of conditions (different carbon sources, stress agents, drugs) following a Randomized Complete Block Design where each plate or experimental batch forms a block . This controls for batch effects while efficiently testing many conditions. Growth measurements should be collected using automated systems for consistency. For genetic interaction screening, Synthetic Genetic Array (SGA) methodology can be employed, crossing YBR051W deletion with genome-wide deletion or hypomorph collections. The experimental design should include appropriate controls on each plate and normalization methods to account for position effects . Metabolomic profiling presents another high-throughput approach, comparing wild-type and YBR051W mutant metabolomes under various conditions. Here, a factorial design testing genotype × condition interactions is appropriate, with randomization of sample processing order . For all high-throughput methods, statistical analysis must account for multiple testing using appropriate correction methods (e.g., Benjamini-Hochberg procedure). Follow-up validation experiments should be designed for the most promising hits, using more targeted approaches with increased replication. This combination of broad screening with focused validation provides a powerful approach to identifying YBR051W functions.

How should I analyze and interpret evolutionary conservation patterns of YBR051W to inform functional hypotheses?

Analyzing evolutionary conservation patterns of YBR051W requires a structured comparative genomics approach. Begin by identifying potential homologs across diverse fungal species using sensitive sequence search methods like PSI-BLAST or HMM-based approaches. Construct multiple sequence alignments and phylogenetic trees to establish orthology relationships and evolutionary history. For the analysis design, systematically sample species across evolutionary distances, including closely related Saccharomyces species, other budding yeasts, filamentous fungi, and potential distant homologs in other kingdoms. Quantify selective pressure using dN/dS analysis across different lineages and protein regions, identifying sites under purifying or positive selection. Construct a data table comparing key metrics across species:

SpeciesHomolog ID% Identity% SimilaritydN/dS ratioConserved DomainsSynteny Conservation
S. cerevisiaeYBR051W100%100%N/AAllReference
S. paradoxusParaXXX94%97%0.12AllComplete
C. glabrataCgXXXX62%78%0.22Domain 1, 2Partial
S. pombeSpXXXX38%52%0.39Domain 1None

Analyze conservation patterns to identify: (1) universally conserved residues suggesting catalytic or structural importance; (2) lineage-specific conservation patterns suggesting specialized functions; (3) co-evolution with other genes suggesting functional relationships. This systematic analysis generates testable hypotheses about YBR051W function based on evolutionary constraints .

How can I integrate results from multiple experimental approaches to develop a comprehensive model of YBR051W function?

Integrating results from multiple experimental approaches to develop a comprehensive model of YBR051W function requires systematic data synthesis and interpretation. Begin by categorizing evidence types (genetic, biochemical, structural, evolutionary) and assigning confidence weights based on methodological rigor and reproducibility. The integration process should follow a structured workflow: First, identify consistent findings across approaches, forming the core of the functional model. Next, address apparent contradictions through careful examination of experimental contexts and conditions. For quantitative integration, develop a scoring system that combines evidence across methods, accounting for their different strengths and limitations. Consider Bayesian approaches that allow updating of functional hypotheses as new evidence emerges. When designing experiments specifically for integration, use factorial or Latin square designs that allow direct comparison of multiple approaches under identical conditions . The comprehensive model should be presented as both a narrative synthesis and visual representations (pathway diagrams, protein interaction networks) that incorporate findings across methods. Finally, identify remaining gaps in understanding and design targeted experiments to address them, prioritizing approaches that complement existing data. This systematic integration transforms diverse experimental results into a coherent functional model of YBR051W that can guide future research .

What mass spectrometry approaches are most effective for identifying post-translational modifications of YBR051W?

Identifying post-translational modifications (PTMs) of YBR051W requires specialized mass spectrometry approaches and careful experimental design. The experimental strategy should begin with expression of tagged YBR051W at near-endogenous levels in S. cerevisiae, followed by affinity purification under conditions that preserve labile modifications. For comprehensive PTM mapping, employ a shotgun proteomics approach using high-resolution LC-MS/MS with multiple fragmentation methods: HCD for general identification and ETD/EThcD for improved PTM localization and characterization. The experimental design should follow a Randomized Complete Block Design, comparing multiple conditions (different growth phases, stress responses) with each experimental batch as a block . For each condition, perform at least three biological replicates with randomized processing order. To improve detection of low-abundance modifications, implement enrichment strategies for specific PTM types: titanium dioxide or IMAC for phosphorylation, antibody-based enrichment for acetylation or ubiquitination. For quantitative analysis of PTM dynamics, employ either label-free quantification or isotopic labeling approaches (SILAC, TMT), with appropriate normalization to protein abundance changes. Data analysis should include rigorous statistical evaluation of site localization scores, requiring FDR < 1% at both peptide and PTM site levels. This comprehensive mass spectrometry approach reveals the PTM landscape of YBR051W, providing insights into its regulation and potential functions .

How should I design reporter assays to study the transcriptional regulation of YBR051W?

Designing reporter assays to study transcriptional regulation of YBR051W requires careful consideration of promoter elements and experimental controls. Begin by conducting in silico analysis of the YBR051W promoter region to identify potential regulatory elements and transcription factor binding sites. Clone a series of promoter fragments of different lengths (e.g., 1kb, 500bp, 250bp upstream of start codon) into a reporter vector containing a quantifiable reporter gene (GFP, luciferase). For the experimental design, employ a Randomized Complete Block Design where each experimental day or plate represents a block, testing all constructs alongside appropriate controls within each block . Essential controls include: empty vector (negative control), constitutive promoter (positive control), and mutated versions of potential regulatory elements. Test reporter activity under various conditions hypothesized to regulate YBR051W expression, creating a factorial design of promoter construct × condition combinations . For each combination, include at least three biological replicates and three technical replicates. Statistical analysis should employ a mixed-effects model with construct and condition as fixed effects and experimental block as a random effect . To validate key findings, complement reporter assays with direct chromatin immunoprecipitation (ChIP) of transcription factors predicted to bind the YBR051W promoter. This comprehensive approach identifies both the regulatory regions and conditions controlling YBR051W expression.

What approaches should be used to study protein-protein interactions involving YBR051W?

Studying protein-protein interactions involving YBR051W requires multiple complementary approaches and rigorous experimental design. Begin with affinity purification-mass spectrometry (AP-MS) using tagged YBR051W expressed at near-endogenous levels. The experimental design should follow a Randomized Complete Block Design, comparing multiple conditions with each experimental batch as a block . Essential controls include untagged strains and strains expressing the tag alone. For validation of key interactions, employ reciprocal tagging and pulldown of candidate interactors. Complement AP-MS with yeast two-hybrid (Y2H) assays, testing both full-length YBR051W and domain constructs as baits against prey libraries or candidate interactors. The Y2H experiments should follow a Completely Randomized Design with appropriate positive and negative controls . For detailed characterization of specific interactions, employ in vitro methods such as surface plasmon resonance or isothermal titration calorimetry to determine binding kinetics and thermodynamics. These biophysical experiments should test multiple concentrations in randomized order with appropriate technical replication. For in vivo validation, use fluorescence techniques such as bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET), designed as factorial experiments testing multiple protein pairs under different conditions . Statistical analysis should account for the specific experimental design used, employing ANOVA or mixed-effects models as appropriate . This multi-method approach provides robust identification and characterization of YBR051W interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.