Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR089W (YBR089W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YBR089W; YBR0811A; Putative uncharacterized protein YBR089W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR089W
Target Protein Sequence
MLVSGCSISTNGFIMTEPDPISPSATNFIVSLVIMILIESLNWDKSRTILENSEDGNDRV ESYCNSSIFKKSASISINFREYSAIRSFLVSSNNKMMESGVLSAISVNVSVLLPQRRILL SEVRSIPNVTGWSHLYSWKASTPISKETNRTLESSTACAMIPSSLHWKLTNWTQSLKPSI ILLKRDASSNFASNIFSLF
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YBR089W and where is it located in the yeast genome?

YBR089W is classified as a dubious open reading frame (ORF) located on chromosome II of Saccharomyces cerevisiae (baker's yeast). According to genomic data, it is positioned at coordinates 425183 to 425782, spanning 600 base pairs of DNA sequence and encoding a putative protein of 199 amino acids . The genomic description indicates it "almost completely overlaps the verified gene POL30" and is "unlikely to encode a functional protein, based on available experimental and comparative sequence data" . This overlapping genomic arrangement raises interesting questions about potential regulatory relationships between these genomic elements.

Why is there no expression data available for YBR089W in standard databases?

The Saccharomyces Genome Database (SGD) explicitly states "No expression data for YBR089W" . This absence of detectable expression under standard conditions reinforces its classification as a dubious ORF. Methodologically, this indicates researchers have attempted to measure YBR089W expression through various techniques including microarray analysis and RNA sequencing across multiple conditions, yet failed to detect significant transcription.

To investigate whether YBR089W might be expressed under specific conditions not captured in standard databases, researchers should design experiments with:

  • Targeted RT-qPCR using primers specific to YBR089W, carefully designed to distinguish it from overlapping POL30 transcripts

  • RNA-seq analysis under diverse stress conditions (oxidative, osmotic, temperature, nutrient deprivation)

  • Nascent transcript analysis using techniques like NET-seq or GRO-seq to capture unstable transcripts that might be missed by standard RNA-seq

The lack of expression data suggests any functional investigation should begin by establishing conditions under which the gene might be transcribed or determining if it has non-coding regulatory functions.

How can computational methods be used to reassess the coding potential of YBR089W?

The coding potential of YBR089W can be reassessed using several advanced computational approaches:

The YZ score method, specifically developed for yeast genome analysis with accuracy exceeding 95%, provides a robust framework for evaluating whether a sequence is likely to be coding or non-coding . This approach is based on the Z curve theory of DNA sequences and calculates a score between 0 and 1, with sequences scoring above 0.5 considered likely to be coding . The mathematical foundation of this approach is:

YZ=F(u)FminFmaxFminYZ = \frac{F(u) - F_{min}}{F_{max} - F_{min}}

Where F(u) represents a decision function based on sequence properties . For YBR089W, calculating this score would provide quantitative assessment of its coding likelihood.

Additionally, researchers should implement:

  • Comparative genomics analysis across multiple yeast species to assess evolutionary conservation patterns

  • Ribosome profiling data analysis to determine if YBR089W is actually translated in vivo

  • Modern machine learning approaches trained on verified yeast coding and non-coding sequences

These computational methods collectively provide a comprehensive reassessment of YBR089W's coding potential beyond simple ORF identification, enabling researchers to quantitatively evaluate its status as a dubious ORF.

What experimental designs can determine if YBR089W has regulatory functions rather than encoding a protein?

To investigate potential regulatory functions of YBR089W independent of protein-coding capacity, researchers should implement the following experimental design:

  • Chromatin Structure Analysis: Perform ATAC-seq or MNase-seq comparing wild-type and YBR089W knockout strains to determine if this region influences local chromatin accessibility, particularly around the overlapping POL30 gene.

  • Regulatory Element Mapping: Use a reporter gene system where fragments of the YBR089W sequence are cloned upstream of a minimal promoter driving luciferase expression. This allows mapping of regions with enhancer or silencer activity.

  • Non-coding RNA Function Analysis: Perform strand-specific RNA-seq to determine if any non-coding transcripts originate from this locus, followed by antisense oligonucleotide-mediated knockdown of any identified transcripts to assess their regulatory impact.

  • DNA-Protein Interaction Mapping: Conduct DNA affinity purification followed by mass spectrometry (DAP-MS) using the YBR089W sequence as bait to identify proteins that might interact specifically with this genomic region.

  • CRISPR Interference/Activation: Use CRISPRi or CRISPRa targeted to different parts of the YBR089W locus to repress or activate the region without altering the sequence, then measure effects on POL30 expression and cellular phenotypes.

These approaches can collectively determine whether YBR089W, despite being unlikely to encode a functional protein, might serve important regulatory functions in yeast genome biology.

What is the relationship between YBR089W and the overlapping verified gene POL30?

The genomic arrangement where YBR089W "almost completely overlaps the verified gene POL30" presents an intriguing case for investigating potential functional or regulatory relationships. POL30 encodes the yeast Proliferating Cell Nuclear Antigen (PCNA), an essential protein involved in DNA replication and repair.

To methodically investigate this relationship, researchers should:

  • Transcriptional Interference Analysis: Measure POL30 expression levels in wild-type versus YBR089W knockout strains using RT-qPCR and Western blotting, under both normal and stress conditions.

  • Chromatin Immunoprecipitation: Perform ChIP-seq for transcription factors and histone modifications across this locus in both wild-type and YBR089W knockout strains to identify any regulatory elements within the YBR089W sequence that might influence POL30 expression.

  • Chromosome Conformation Capture: Use 3C/4C/Hi-C techniques to determine if the YBR089W region participates in long-range chromosomal interactions that might regulate POL30 or other genes.

  • Genetic Complementation: Create precise deletions of YBR089W that preserve POL30 integrity, followed by reintroduction of YBR089W under an inducible promoter to assess rescue of any observed phenotypes.

This overlapping arrangement may represent an evolutionary solution for compact genome organization or might indicate a regulatory relationship where YBR089W sequence elements influence POL30 expression, despite not encoding a functional protein themselves.

What are the optimal conditions for expressing and purifying recombinant YBR089W protein?

Based on commercial production methods, the following protocol represents optimal conditions for recombinant YBR089W expression and purification:

Expression System: E. coli has been successfully used to express full-length YBR089W protein (1-199 amino acids) with an N-terminal His-tag . This bacterial system provides efficient expression for this relatively small (199aa) yeast protein.

Protein Characteristics and Handling:

ParameterSpecificationNotes
Protein LengthFull Length (1-199aa)Complete sequence required for functional studies
TagN-terminal His-tagFacilitates purification via IMAC
FormLyophilized powderOptimal for shipping and storage stability
Purity>90% by SDS-PAGESufficient for most research applications
Storage BufferTris/PBS-based with 6% Trehalose, pH 8.0Maintains protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol for long-term storage
Storage-20°C/-80°CAliquot to avoid freeze-thaw cycles

Protocol Recommendations:

  • Centrifuge vial briefly before opening to bring contents to bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to final concentration of 50% for long-term storage

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

These conditions have been optimized through commercial production and should provide a starting point for researchers expressing this protein for investigational purposes.

What controls should be included when working with YBR089W knockout strains?

When designing experiments with YBR089W knockout strains, appropriate controls are essential for valid interpretation of results:

Essential Controls for YBR089W Knockout Experiments:

  • Wild-type Parental Strain: The original BY4743, BY4741, or BY4742 strain (depending on which background the knockout was created in) must be included as the primary control to establish baseline phenotypes.

  • POL30 Expression Control: Since YBR089W overlaps with POL30, measuring POL30 expression levels in both wild-type and knockout strains is critical to determine whether any phenotypes might result from altered POL30 expression rather than YBR089W absence.

  • Complementation Strain: A strain where YBR089W is reintroduced on a plasmid under its native promoter to verify that any observed phenotypes can be rescued.

  • Additional Knockout Controls: Include knockouts of other dubious ORFs as negative controls and functionally related genes as positive controls.

  • Growth Media Controls: Test phenotypes on different media types (minimal, rich, with various carbon sources) as dubious ORFs may have condition-specific functions.

These controls account for the unique genomic context of YBR089W and ensure that experimental observations can be correctly attributed to the specific genomic manipulation rather than to secondary effects or strain variation.

How can researchers generate and validate modified versions of YBR089W for functional studies?

To investigate potential functions of YBR089W, researchers may need to generate modified versions with various tags or mutations. A comprehensive methodology includes:

Generation Approaches:

  • PCR-Based Tagging: Using specialized primers with homology arms flanking the YBR089W locus and containing the desired tag sequence (GFP, FLAG, HA), followed by transformation into yeast.

  • CRISPR-Cas9 Editing: Design guide RNAs targeting specific regions of YBR089W and donor DNA containing the desired modifications, allowing precise modifications without disrupting the overlapping POL30 gene.

  • Plasmid-Based Expression: Cloning modified versions of YBR089W into yeast expression vectors under native or regulatable promoters (GAL1, CUP1) for controlled expression studies.

Validation Protocol:

  • Genomic Verification: PCR amplification across the modification site followed by sequencing to confirm correct integration.

  • Expression Verification:

    • Western blotting using antibodies against the introduced tag

    • RT-qPCR to measure transcript levels of modified YBR089W

  • Localization Analysis: If fluorescent tags are used, microscopy to determine subcellular localization of the tagged protein.

  • Functional Verification: Phenotypic assays comparing modified strains to both wild-type and knockout strains under various growth conditions.

  • Interaction Verification: If studying protein-protein interactions, co-immunoprecipitation followed by mass spectrometry to identify binding partners.

This methodical approach ensures that any modified versions of YBR089W are correctly generated and validated before being used in functional studies, particularly important given its status as a dubious ORF.

How does research on YBR089W contribute to our understanding of dubious ORFs in yeast genomics?

Research on YBR089W serves as a valuable case study in how genomics approaches classify and investigate potentially non-functional regions of the genome. The classification of this ORF as "dubious" exemplifies the challenges in definitively determining which open reading frames encode functional proteins in complex genomes.

Advanced computational methods like the YZ score system have improved our ability to distinguish coding from non-coding sequences with high accuracy , yet examples like YBR089W demonstrate the ongoing need for experimental validation. The fact that commercial entities produce both knockout strains and recombinant proteins for this dubious ORF reflects the scientific community's interest in definitively resolving its status.

The overlapping arrangement with POL30 also illustrates the complex genomic architecture in yeast, where genomic regions may serve multiple purposes. Investigating whether YBR089W has any regulatory effect on POL30 expression could reveal new paradigms for gene regulation through overlapping genomic elements.

As genomic and transcriptomic technologies continue to advance, dubious ORFs like YBR089W serve as important test cases for refining our understanding of what constitutes a gene and how we define functionality in the post-genomic era. This research contributes to the broader field of functional genomics by challenging our assumptions about non-coding regions and potentially revealing overlooked functions in previously dismissed genomic elements.

What future research directions might clarify the biological significance of YBR089W?

Future research on YBR089W should focus on three complementary approaches:

  • Comparative Genomics Extension: Examining the evolutionary conservation of this locus across multiple yeast species and strains beyond S. cerevisiae S288c would reveal whether the sequence is maintained under selective pressure despite being classified as dubious. Methodologically, this would involve whole-genome alignments and analysis of selection signatures using metrics like dN/dS ratios.

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and YBR089W knockout strains under diverse conditions could reveal subtle phenotypes or regulatory effects not detectable by single-approach methods. This comprehensive profiling approach could identify condition-specific functions or system-wide effects that explain why this sequence is maintained in the genome.

  • Advanced Functional Genomics: Employing CRISPR screening approaches to introduce precise mutations throughout the YBR089W locus while monitoring effects on POL30 expression and cellular fitness would map any functional elements within this region. This fine-mapping approach could distinguish between protein-coding function and sequence-dependent regulatory effects.

These research directions collectively provide a path toward resolving the biological significance of YBR089W, potentially reclassifying it from "dubious" to a recognized genomic element with defined function, whether coding or regulatory.

What are the implications of studying dubious ORFs like YBR089W for broader genome annotation efforts?

The continued investigation of dubious ORFs like YBR089W has several important implications for genome annotation:

  • Annotation Refinement: Studies of dubious ORFs provide crucial data for improving genome annotation algorithms. The YZ score method demonstrates how specialized algorithms can achieve >95% accuracy in distinguishing coding from non-coding sequences in yeast . Experimental validation of these computational predictions using YBR089W and similar cases helps refine these methods.

  • Regulatory Element Discovery: Many sequences initially classified as dubious ORFs may actually represent regulatory elements rather than protein-coding genes. Methodical investigation of YBR089W's potential impact on the overlapping POL30 gene could reveal principles for identifying and categorizing such regulatory regions, particularly in compact genomes.

  • Evolutionary Insights: Understanding why sequences like YBR089W are maintained in the genome despite lacking apparent protein-coding function provides insights into genome evolution and organization. Methodologically, comparative analysis across multiple yeast species can reveal whether conservation patterns suggest functional constraints beyond protein-coding capacity.

  • Functional Genomics Advancement: The development of methods to study dubious ORFs like YBR089W advances the broader field of functional genomics, creating new approaches for investigating genomic dark matter in more complex organisms including humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.