Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR099C (YBR099C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YBR099C; YBR0828; Putative uncharacterized protein YBR099C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR099C
Target Protein Sequence
MRCFPINDTRFGRELINSICEFTVCILTCHSLSMKRNRCSKSNFFIPNFPTWLDFLLLGL KASSVPDNRCSTLALYFSFSNWKIALLSLFISLSIRITCFPFFEKNRIFLYNSFFCEVYC SKNSCAS
Uniprot No.

Target Background

Database Links

STRING: 4932.YBR099C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is currently known about the putative uncharacterized protein YBR099C in Saccharomyces cerevisiae?

YBR099C is a putative uncharacterized protein in the budding yeast Saccharomyces cerevisiae. While specific functional annotations remain limited, phylogenetic profiling approaches suggest it may play a role in metabolic pathways or structural complexes. The functional prediction approach described by Pellegrini et al. demonstrates that proteins with similar phylogenetic profiles (presence/absence patterns across multiple genomes) often have related functions . This offers a starting point for characterizing YBR099C by examining its evolutionary co-occurrence with proteins of known function.

What expression systems are most suitable for recombinant production of YBR099C?

For recombinant production of YBR099C, homologous expression in S. cerevisiae offers significant advantages over heterologous systems like E. coli. S. cerevisiae provides the appropriate eukaryotic cellular machinery, post-translational modifications, and native folding environment that may be essential for YBR099C's functional structure . While E. coli remains popular for protein expression (accounting for a large percentage of recombinant protein production), S. cerevisiae should be considered at an early stage for challenging eukaryotic proteins . For higher biomass yields, Pichia pastoris can also be considered as an alternative yeast expression system .

How can I optimize vector selection for efficient YBR099C expression?

Vector selection should be based on experimental objectives. For constitutive expression, GAP promoter-based vectors like pGAPZαC are recommended, as demonstrated in the construction of recombinant S. cerevisiae with overexpressed aldehyde reductase . This approach provides consistent expression without induction requirements. For controlled expression, inducible promoters may be preferred. When designing your expression construct, consider including:

  • A secretion signal (like α-factor) if secretion is desired

  • Appropriate selection markers (histidine, uracil, or antibiotic resistance)

  • Affinity tags (His-tag, as used in the ari1 overexpression study) for purification and detection

  • Codon optimization for improved expression levels

What are the optimal growth conditions for maximizing YBR099C expression in recombinant S. cerevisiae?

Optimal conditions for maximizing YBR099C expression require careful consideration of growth parameters:

  • Media selection: Complete YPD medium supports robust growth, though defined synthetic media may be preferred for consistent experimental conditions .

  • Growth parameters: Maintain cultures at 30°C with agitation (200-250 rpm) to ensure adequate aeration.

  • Expression kinetics: Monitor expression over time to determine optimal harvest point, as protein accumulation may not correlate directly with cell density.

  • Stress consideration: The unfolded protein response (UPR) plays a significant role in high-yielding yeast cultures. Research indicates that reduced translational activity can actually improve recombinant protein yields by preventing cellular stress responses . Consider using strains with modified UPR pathways for potentially improved YBR099C yields.

  • Metabolic adjustments: For constitutive expression systems, ensure adequate carbon source availability throughout the growth phase.

What purification strategy is most effective for isolating YBR099C while maintaining protein functionality?

A multi-step purification strategy is recommended for isolating functional YBR099C:

  • Cell disruption: For intracellular YBR099C, use mechanical disruption (glass beads or homogenization) in a buffer containing protease inhibitors to prevent degradation.

  • Initial clarification: Remove cell debris by centrifugation (10,000×g, 20 minutes).

  • Affinity chromatography: If YBR099C was tagged with His-tag (as demonstrated in the aldehyde reductase study), use immobilized metal affinity chromatography (IMAC) for initial purification .

  • Secondary purification: Ion exchange chromatography based on YBR099C's predicted isoelectric point can provide additional purification.

  • Final polishing: Size exclusion chromatography to achieve high purity and remove aggregates.

  • Quality assessment: Verify purity by SDS-PAGE and Western blotting with anti-His antibodies if tagged .

  • Functional validation: Develop activity assays based on predicted function from phylogenetic profiling .

How can I assess the structural integrity of purified YBR099C?

Multiple complementary techniques should be employed to assess structural integrity:

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure elements (α-helices, β-sheets) to confirm proper folding.

  • Dynamic light scattering (DLS): Evaluate size distribution to detect aggregation or oligomerization.

  • Thermal shift assays: Measure protein stability under various buffer conditions to optimize storage.

  • Limited proteolysis: Determine accessibility of cleavage sites as an indicator of proper folding.

  • Native PAGE: Assess oligomeric state and confirm homogeneity.

When interpreting results, remember that as an uncharacterized protein, reference data for comparison may be limited, so comparative analysis with proteins of similar size or predicted structure may be necessary.

What computational approaches can predict potential functions of YBR099C?

Several computational approaches can provide functional insights into YBR099C:

  • Phylogenetic profiling: As demonstrated by Pellegrini et al., this approach identifies proteins with similar patterns of presence/absence across species, suggesting functional linkage . The table below shows how this approach can reveal functional relationships:

Functional ClassProteins with Similar Profiles to TargetRandom Expectation
Carbon compounds9.1× enrichmentBaseline
Respiration4.2× enrichmentBaseline
Electron transport3.5× enrichmentBaseline
  • Protein domain analysis: Identify conserved domains that might indicate function.

  • Structural prediction: Use AlphaFold or similar tools to predict 3D structure, which can suggest functional sites.

  • Protein-protein interaction predictions: Computational prediction of interaction partners can suggest functional pathways.

  • Gene neighborhood analysis: Examining genomic context in S. cerevisiae and related species can provide functional clues.

What in vivo experimental approaches are most effective for determining YBR099C function?

In vivo approaches to determine YBR099C function include:

  • Gene knockout/knockdown: Generate YBR099C-deficient strains and characterize resulting phenotypes using growth curves, stress response assays, and metabolic profiling. Compare growth patterns to wild-type strains under various conditions as demonstrated in the furfural/HMF toxicity studies .

  • Overexpression analysis: Similar to the ari1 overexpression study, create YBR099C overexpression strains and assess phenotypic changes .

  • Protein localization: Use fluorescent protein fusions to determine subcellular localization, as shown in the confocal microscopy approach used for membrane protein localization .

  • Synthetic genetic interaction screening: Identify genetic interactions by creating double mutants with known pathway components.

  • Transcriptomic analysis: Perform RNA-seq on knockout/overexpression strains to identify affected pathways.

  • Metabolomic profiling: Analyze metabolite changes in modified strains to identify affected biochemical pathways.

How can I design in vitro assays to evaluate potential enzymatic activities of YBR099C?

When designing in vitro assays for YBR099C:

  • Predict potential activities: Use computational analysis to identify potential enzymatic activities based on sequence homology or structural predictions.

  • General activity screening: Test for common enzymatic activities (oxidoreductase, transferase, hydrolase) using broad-spectrum assays.

  • Cofactor identification: Assess binding of common cofactors (NAD(P)H, ATP, metal ions) through thermal shift assays or activity dependency.

  • Substrate screening: Perform targeted substrate screens based on phylogenetic profiling results that suggest metabolic pathway involvement .

  • Kinetic characterization: Once activity is identified, determine kinetic parameters (Km, Vmax, kcat) under various conditions.

  • Inhibitor studies: Use selective inhibitors to confirm the nature of the enzymatic activity.

  • Activity validation: Confirm relevance of in vitro activity through complementation studies in knockout strains.

How can I optimize YBR099C expression for structural biology applications?

Optimizing YBR099C expression for structural biology requires:

  • Construct optimization: Create truncated constructs removing potential disordered regions that may hinder crystallization. Incorporate surface entropy reduction mutations to promote crystal contacts.

  • Expression strain selection: Use specialized S. cerevisiae strains with improved protein folding capabilities. As demonstrated by Bill et al., selection of specific yeast strains can dramatically improve expression of challenging proteins compared to wild-type cells .

  • Isotopic labeling: For NMR studies, develop protocols for uniform or selective isotopic labeling using defined media containing 15N-ammonium sulfate and 13C-glucose.

  • Expression conditions: Implement a Design of Experiments (DoE) approach to systematically optimize temperature, induction time, and media composition .

  • Protein engineering: Introduce disulfide bonds or thermostabilizing mutations to enhance stability.

  • Co-expression strategies: Identify potential binding partners through phylogenetic profiling and consider co-expression to stabilize protein complexes .

  • Quality control: Implement rigorous homogeneity assessment using size-exclusion chromatography coupled with multi-angle light scattering.

What are the most effective strategies for identifying interaction partners of YBR099C?

Multiple complementary approaches should be employed to identify interaction partners:

  • Affinity purification-mass spectrometry (AP-MS): Express tagged YBR099C and identify co-purifying proteins through mass spectrometry.

  • Yeast two-hybrid screening: Use YBR099C as bait to screen S. cerevisiae genomic libraries.

  • Proximity labeling approaches: Employ BioID or APEX2 fusions to identify proteins in close proximity to YBR099C in vivo.

  • Co-immunoprecipitation: Use antibodies against tagged YBR099C to pull down interacting proteins.

  • Computational prediction validation: Experimentally validate interactions predicted through phylogenetic profiling .

  • Crosslinking mass spectrometry: Employ chemical crosslinking followed by mass spectrometry to identify interaction interfaces.

  • Functional validation: Confirm biological relevance of identified interactions through genetic interaction studies or co-localization experiments.

How can CRISPR-Cas9 genome editing be used to study YBR099C function in S. cerevisiae?

CRISPR-Cas9 genome editing offers powerful approaches for studying YBR099C:

  • Precise gene deletion: Create clean YBR099C knockouts without marker genes or scar sequences.

  • Point mutations: Introduce specific mutations to test the importance of predicted functional residues.

  • Endogenous tagging: Add fluorescent or affinity tags to the endogenous YBR099C locus to study the native protein.

  • Promoter engineering: Modify the endogenous promoter to create conditional expression systems.

  • Regulatory element analysis: Systematically edit putative regulatory regions to understand transcriptional control.

  • Multiplex editing: Simultaneously edit YBR099C and potential interacting partners identified through phylogenetic profiling .

  • Base editing: Utilize CRISPR base editors for precise nucleotide substitutions without double-strand breaks.

For optimal results, design guide RNAs with minimal off-target effects and include appropriate controls to validate editing efficiency and specificity.

How can I address low expression levels of recombinant YBR099C in S. cerevisiae?

Low expression can be addressed through systematic optimization:

  • Codon optimization: Adapt the YBR099C coding sequence to preferred codon usage in S. cerevisiae.

  • Strain selection: Test expression in specialized strains with reduced UPR activation and lower translational activity, which have shown improved yields for challenging proteins .

  • Promoter selection: Compare different promoter strengths (GAP, TEF, ADH1) to identify optimal expression levels.

  • Growth optimization: Implement a Design of Experiments approach to systematically optimize media composition, temperature, and induction parameters .

  • Protein engineering: Create fusion proteins with well-expressed partners or solubility-enhancing tags.

  • Stress reduction: Consider lower temperature expression or supplementing with chemical chaperones to reduce protein misfolding.

  • Induction strategy: For inducible systems, test various induction protocols including pulsed induction which has shown benefits in P. pastoris .

What approaches can resolve issues with YBR099C protein instability or aggregation?

To address stability and aggregation issues:

  • Buffer optimization: Systematically screen buffers, pH conditions, and additives using thermal shift assays to identify stabilizing conditions.

  • Detergent screening: If YBR099C shows hydrophobic characteristics, test various detergents for their ability to prevent aggregation.

  • Truncation constructs: Design and test truncated versions to identify more stable domains.

  • Co-expression strategies: Express YBR099C with potential binding partners identified through phylogenetic profiling to promote stable complex formation .

  • Targeted mutagenesis: Identify and modify aggregation-prone regions through computational prediction and site-directed mutagenesis.

  • Fusion partners: Create fusions with solubility-enhancing proteins like thioredoxin or MBP.

  • Expression conditions: Lower expression temperature and reduce induction strength to allow more time for proper folding.

How can I validate that my recombinant YBR099C retains its native functional properties?

Validation of native functional properties requires multiple approaches:

  • Complementation assays: Test whether recombinant YBR099C can rescue phenotypes in knockout strains.

  • Activity comparison: Compare specific activities of recombinant and native (immunoprecipitated) YBR099C.

  • Structural validation: Use limited proteolysis patterns or CD spectroscopy to compare structural properties.

  • Interactome analysis: Verify that recombinant YBR099C maintains expected protein-protein interactions.

  • Post-translational modification analysis: Confirm that recombinant YBR099C carries the same modifications as the native protein using mass spectrometry.

  • Subcellular localization: Ensure recombinant YBR099C localizes to the same cellular compartments as the native protein.

  • Stress response: Evaluate whether recombinant YBR099C confers expected stress response properties, similar to how ari1 overexpression affected furfural and HMF tolerance .

What emerging technologies show promise for advancing YBR099C characterization?

Several emerging technologies offer new approaches for YBR099C characterization:

  • Cryo-electron microscopy: Enables structural determination of YBR099C or its complexes without crystallization.

  • Single-molecule techniques: Allow analysis of YBR099C dynamics and interactions at the individual molecule level.

  • Integrative structural biology: Combines multiple data types (crosslinking, NMR, SAXS) to determine structures of challenging proteins.

  • Proteome-wide interaction mapping: Technologies like protein correlation profiling can place YBR099C in functional networks.

  • Deep mutational scanning: Systematically assesses the impact of thousands of mutations on YBR099C function.

  • Synthetic biology approaches: Reconstitution of minimal pathways containing YBR099C to determine its role.

  • Advanced computational prediction: Emerging AI-based approaches may provide more accurate functional predictions for uncharacterized proteins like YBR099C beyond traditional phylogenetic profiling .

How should researchers design comprehensive studies to fully characterize the function of YBR099C in cellular pathways?

A comprehensive characterization strategy should include:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from YBR099C-modified strains.

  • Condition-specific phenotyping: Assess phenotypes under various stress conditions, carbon sources, and growth phases.

  • Evolutionary context: Examine YBR099C orthologs in related species to understand functional conservation and divergence.

  • Synthetic genetic interaction mapping: Create double mutants with genes in predicted pathways to identify functional relationships.

  • Temporal dynamics: Study YBR099C expression, localization, and modification throughout the cell cycle and under stress conditions.

  • Structure-function relationships: Correlate structural features with functional roles through targeted mutagenesis.

  • Systems biology modeling: Integrate experimental data into pathway models to predict system-wide effects of YBR099C perturbation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.