Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR116C (YBR116C)

Shipped with Ice Packs
In Stock

Description

Definition and Background

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR116C (YBR116C) refers to a genetically engineered version of a protein encoded by the YBR116C gene in Saccharomyces cerevisiae (baker’s yeast). The protein is labeled as "putative" and "uncharacterized," indicating its biological function remains unclear despite computational predictions and experimental studies . It is produced via recombinant DNA technology, typically in E. coli, and is used in research to study its potential roles in yeast metabolism, stress response, or cellular pathways .

Predicted Interactions and Pathway Involvement

Bioinformatics tools like STRING (Search Tool for the Retrieval of Interacting Genes/Proteins) suggest potential interactions with known yeast proteins :

Interacting PartnerFunctionInteraction Score
TKL2Transketolase in the pentose phosphate pathway (aromatic amino acid synthesis).0.839
YIR016WPutative protein with roles in cell cycle regulation and stress response.0.772
GRE1Stress-induced hydrophilin (osmotic/oxidative stress tolerance).0.615

These predictions imply YBR116C may participate in metabolic adaptation or stress response, though experimental validation is lacking .

Metabolic Profiling and Gene Deletion Studies

Deletion of YBR116C in S. cerevisiae has been analyzed under exponential growth in minimal media. While specific metabolic changes were not detailed, the gene clusters with others influencing amino acid homeostasis and carbon metabolism . For example:

  • Amino Acid Metabolism: Co-clustering with genes like ARO10 (aromatic amino acid metabolism) and PUT4 (proline transport) .

  • Carbohydrate Metabolism: Potential links to TKL2 (pentose phosphate pathway) and GPP2 (glycerol metabolism) .

Expression and Dubious Gene Status

  • Expression Data: No experimental expression data are available for YBR116C .

  • Gene Validity: UniProt labels YBR116C as a "dubious gene prediction," suggesting it may not encode a functional protein due to overlapping with TKL2 and weak sequence conservation .

Polyclonal rabbit antibodies specific to YBR116C are available for Western blot (WB) and ELISA applications , though their utility is limited by the protein’s uncharacterized nature.

Controversies and Challenges

  • Functional Ambiguity: Despite its presence in metabolic gene clusters, YBR116C lacks direct experimental evidence of function .

  • Genomic Overlap: Partial overlap with TKL2 raises doubts about its independent transcriptional regulation and protein viability .

  • Research Gaps: No peer-reviewed studies directly investigating YBR116C’s role in S. cerevisiae physiology, necessitating caution in interpreting bioinformatics predictions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
YBR116C; YBR0911; Putative uncharacterized protein YBR116C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR116C
Target Protein Sequence
MQPKNCTILKKSKQELFPCQTFILLTGKVKNTDSLFYQTVFRSCPLKYWLLQAGVSMLIN RSDSTNLVVQARGLKFTNCSISQRTVLRQGLKRQSITTKESSCFLLWEELSKSEEVNSSL LFHTSWLMVTCCLKYIYMYDICTCFLFCAFVTSIFIETDYSIFFLLTASRGIAQF
Uniprot No.

Target Background

Database Links

STRING: 4932.YBR116C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the primary structure and basic properties of YBR116C protein?

YBR116C is a putative uncharacterized protein from Saccharomyces cerevisiae with a full length of 175 amino acids. It is available as a recombinant protein with His-tag for research purposes. The protein's molecular function remains largely uncharacterized, which presents opportunities for novel research into its structure-function relationships. When working with this protein, researchers should consider starting with basic structural analysis techniques such as circular dichroism spectroscopy, size exclusion chromatography, and protein crystallography to establish fundamental properties .

How is YBR116C gene expression regulated in Saccharomyces cerevisiae?

The regulation of YBR116C expression remains a research area with limited published data. To investigate this question, researchers should employ a combination of transcriptomics approaches, including RNA-Seq under various growth conditions and stressors. Quantitative PCR can be used to validate expression patterns, while reporter gene assays with the YBR116C promoter can help identify regulatory elements. Chromosome conformation capture techniques may reveal long-range interactions influencing expression. This multi-faceted approach will help construct a comprehensive understanding of YBR116C regulation within the complex yeast gene expression network .

What are the optimal expression systems and conditions for producing recombinant YBR116C protein?

For recombinant YBR116C expression, E. coli systems have been successfully employed as indicated by commercial sources. The optimal expression protocol typically involves BL21(DE3) or Rosetta strains with IPTG induction at lower temperatures (16-25°C) to enhance soluble protein yield. For challenging expression scenarios, consider specialized vectors with solubility-enhancing tags beyond the standard His-tag, such as MBP or SUMO fusion systems. Alternative expression hosts worth exploring include Pichia pastoris for eukaryotic post-translational modifications or cell-free systems for potentially toxic proteins. Expression optimization should systematically evaluate variables including media composition, induction timing, expression temperature, and inducer concentration through factorial design experiments .

What purification strategies yield the highest purity and activity for recombinant YBR116C?

Purification of His-tagged recombinant YBR116C protein typically follows a multi-step process beginning with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin. For highest purity, this should be followed by secondary purification steps such as ion exchange chromatography and size exclusion chromatography. Critical parameters to optimize include buffer composition (particularly pH and salt concentration), imidazole gradient profiles for elution, and the addition of reducing agents to prevent aggregation. Protein activity should be monitored throughout purification using appropriate functional assays, though these may need to be developed specifically for YBR116C given its uncharacterized nature. The final purified product should undergo quality control via SDS-PAGE, western blotting, and mass spectrometry to confirm identity and purity .

What experimental approaches can uncover the biological function of YBR116C?

To elucidate the biological function of the uncharacterized YBR116C protein, researchers should implement a comprehensive strategy combining genetic, biochemical, and computational approaches. Begin with phenotypic analysis of YBR116C deletion mutants across diverse growth conditions to identify functional defects. Complement this with protein interaction studies using yeast two-hybrid screens, co-immunoprecipitation followed by mass spectrometry, and proximity labeling techniques to map the protein's interaction network. Subcellular localization studies using fluorescent protein fusions can provide contextual clues. RNA-seq and proteomics comparisons between wild-type and knockout strains can identify affected pathways. Computational approaches including phylogenetic profiling and structural modeling may generate functional hypotheses. Finally, metabolic profiling can reveal altered metabolic pathways in mutants. This multi-faceted approach maximizes the chances of functional discovery for this uncharacterized protein .

How can YBR116C be utilized in recombinant yeast systems for immunological research?

Though specific immunological applications of YBR116C haven't been directly documented, the research on recombinant S. cerevisiae systems provides a framework for potential applications. Recombinant S. cerevisiae has been successfully used as whole, heat-killed vectors engineered to express target proteins that stimulate immune responses. To adapt this approach for YBR116C research, the protein could be co-expressed with immunologically relevant targets to investigate potential adjuvant or immunomodulatory properties. The experimental design would involve engineering yeast strains expressing YBR116C alongside known antigens, followed by in vitro testing with dendritic cells to assess activation markers and cytokine profiles. In vivo studies could measure antigen-specific T-cell responses. This methodology leverages the advantages of yeast-based systems, which are efficiently manufactured, not neutralized by antibodies, and can be used for both priming and boosting immune responses .

How can CRISPR-Cas9 genome editing be optimized for studying YBR116C function in Saccharomyces cerevisiae?

Optimizing CRISPR-Cas9 for YBR116C functional studies requires careful experimental design. First, select guide RNAs targeting multiple sites within the YBR116C coding sequence using yeast-optimized algorithms that account for chromatin accessibility and minimize off-target effects. Deliver the CRISPR-Cas9 components via plasmid-based systems with appropriate selection markers, optimizing transformation protocols for high efficiency. For precise gene editing, co-transform with repair templates containing desired modifications and homology arms extending 500-1000bp from the cut site. To generate conditional alleles, consider implementing auxiliary techniques such as AID (auxin-inducible degron) or temperature-sensitive mutations. Verify editing through sequencing and confirm the absence of off-target modifications via whole-genome sequencing of edited strains. For phenotypic characterization, employ high-throughput approaches including growth curve analysis under diverse conditions, high-content microscopy, and multi-omics profiling. This comprehensive approach enables precise manipulation of YBR116C to systematically investigate its function .

What strategies can overcome solubility and stability issues when working with recombinant YBR116C protein?

Addressing solubility and stability challenges with recombinant YBR116C requires a systematic approach. First, implement expression optimization by reducing induction temperature (16-20°C), decreasing inducer concentration, and using specialized E. coli strains like Rosetta or Arctic Express. If insolubility persists, explore fusion partners known to enhance solubility (SUMO, MBP, TrxA) with optimized linker regions. Buffer optimization is crucial – screen various pH values (typically 6.0-8.5), salt concentrations (100-500mM NaCl), and additives including glycerol (5-10%), reducing agents (DTT or TCEP), and specific stabilizers like arginine or proline. For particularly challenging cases, consider in silico analysis to identify aggregation-prone regions and introduce targeted mutations. Refolding protocols from inclusion bodies represent an alternative approach, utilizing step-wise dialysis with chaperone assistance. Finally, stability during storage can be enhanced through flash-freezing in small aliquots with cryoprotectants and systematic testing of various storage conditions. Document all optimization steps methodically to generate a reproducible protocol .

What potential biotechnological applications exist for YBR116C beyond basic research?

While YBR116C remains uncharacterized, its potential biotechnological applications can be explored through comparative analysis with similar yeast proteins. Possible applications include development as a novel protein scaffold for enzyme engineering, exploration as a component in synthetic biology circuits in S. cerevisiae, or investigation as a potential target for antifungal drug development. The protein could also serve as a model for studying evolution of "orphan" genes with unknown function. To pursue these applications, researchers should first complete comprehensive function characterization through structure determination, domain analysis, and interactome mapping. Bioengineering approaches could then explore protein modifications to confer novel functions. Any commercial application would require optimization of expression systems for scale-up production while maintaining proper folding and functionality. This structured approach transforms an uncharacterized protein into a potential biotechnological tool through systematic research and development .

How might YBR116C research contribute to our understanding of yeast as immunotherapy vectors?

YBR116C research could significantly enhance our understanding of yeast-based immunotherapy platforms by investigating its potential role in immune response modulation. Building on established work with recombinant S. cerevisiae as immunotherapy vectors, researchers should first characterize the immunogenicity profile of YBR116C-expressing yeast through in vitro dendritic cell activation assays measuring cytokine production, surface marker expression, and T-cell priming capacity. Comparative studies between wild-type and YBR116C-modified yeast could reveal whether this protein enhances or suppresses immune recognition. Animal model studies would be essential to assess in vivo immune responses. If immunomodulatory properties are identified, mechanistic studies should investigate the protein's interaction with pattern recognition receptors and signaling pathways in immune cells. These findings could potentially lead to designing optimized yeast vectors for cancer immunotherapy or vaccine development by incorporating YBR116C modifications that enhance desired immune responses while minimizing adverse effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.