Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR124W (YBR124W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
YBR124W; YBR0920B; Putative uncharacterized protein YBR124W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR124W
Target Protein Sequence
MPPHIFIAFCILECFVETLSGNSKLGILGRSNVNSSAINGGAWSALESGIDESVARGSST GIFTIWKIFSLLKAIEINYVFPLVYLFCVVFQFLSLGCYLSIFFRKTKSEEAKKRTSLY
Uniprot No.

Target Background

Database Links

STRING: 4932.YBR124W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression patterns does YBR124W exhibit under different conditions?

Surprisingly, standard expression databases show limited data for YBR124W expression under normal growth conditions. The Saccharomyces Genome Database reports "No expression data for YBR124W" , suggesting that YBR124W may be expressed at very low levels under standard laboratory conditions or may require specific conditions for expression.

GeneRed IntensityGreen Intensity
YBR124W9278

These relatively low intensity values compared to other genes in the same experiment (like RPS11B with values of 3855/3739) suggest that YBR124W is expressed at low levels even in aging yeast cells . This pattern is consistent with many uncharacterized yeast genes that may be conditionally expressed or maintained at basal levels under laboratory conditions.

Methodologically, researchers studying YBR124W expression should consider using more sensitive techniques than microarrays, such as RT-qPCR or RNA-Seq, and should explore various stress conditions that might induce its expression.

What experimental resources are available for studying YBR124W?

Several key resources are available for researchers investigating YBR124W:

Knockout strains: Complete deletion strains of YBR124W are available in multiple genetic backgrounds:

  • Haploid strains (BY4741 MATa and BY4742 MATα)

  • Homozygous and heterozygous diploid strains (BY4743)

These knockout strains can be used in phenotypic screens to identify conditions where YBR124W may play a role.

Recombinant protein: Full-length YBR124W protein with an N-terminal His-tag is commercially available, expressed in E. coli . Specifications include:

  • Expression system: E. coli

  • Tag: His (N-terminal)

  • Form: Lyophilized powder

  • Purity: >90% as determined by SDS-PAGE

  • Recommended storage: -20°C/-80°C, with 5-50% glycerol for long-term storage

Database resources: YBR124W is cataloged in the Saccharomyces Genome Database (SGD), which provides updated annotation information, though functional data remains limited .

How can genetic screens be designed to identify potential functions of YBR124W?

Genetic screens represent a powerful approach to uncovering functions of uncharacterized genes like YBR124W. Several methodologies are particularly relevant:

Phenotypic screening of knockout strains: The ΔYbr124w strain can be subjected to various growth conditions including different:

  • Carbon sources (glucose, galactose, glycerol)

  • Nitrogen sources (ammonium, amino acids)

  • Stress conditions (oxidative, osmotic, pH variations)

  • Temperature ranges

  • Heavy metal exposures

SATAY (Saturated Transposition in Yeast): This technique uses transposon insertion to create genome-wide mutations and can reveal genetic interactions involving YBR124W. The method identifies:

  • Essential genes and essential protein domains

  • Positive and negative genetic interactions

  • Novel gene functions through phenotypic selection

Systematic genetic interaction mapping: Creating double mutants with ΔYbr124w and other yeast deletion strains can reveal synthetic lethality or other genetic interactions that suggest functional relationships.

Growth measurements should be quantitative, recording parameters such as lag phase duration, growth rate, and maximum cell density under different conditions to detect subtle phenotypes .

What experimental designs are most appropriate for investigating stress responses that might involve YBR124W?

Based on studies of other uncharacterized yeast proteins, several experimental approaches are recommended for investigating potential stress-related functions of YBR124W:

Time-course experiments: This design measures responses at multiple time points after application of a stress condition, allowing detection of both immediate and adaptive responses . For YBR124W, consider:

  • Sampling at 0, 0.5, 1, 1.5, 3, and 6 hours post-stress

  • Measuring both protein levels (Western blot) and mRNA expression (RT-qPCR)

  • Monitoring subcellular localization changes using GFP-tagged constructs

Dose-response experiments: Expose yeast cells to increasing concentrations of stressors to determine response thresholds:

StressorRecommended concentration range
Heavy metals (Mn2+, Cd2+)0.5-5 mM
Oxidative stress (H2O2)0.5-4 mM
pH stresspH 3.5-8.0
DNP (2,4-dinitrophenol)0.05-0.5 mM

Controlled comparison designs: Use the following strains for comparative analysis:

  • Wild-type (BY4742)

  • ΔYbr124w knockout

  • YBR124W-GFP fusion strain

  • YBR124W overexpression strain

For stress induction protocols, cells should be grown to mid-log phase (OD600 ≈ 0.6-0.8) before stress application to ensure consistency . Statistical analysis should employ ANOVA with post-hoc tests to identify significant differences between conditions and genotypes.

How can protein localization studies be optimized for YBR124W characterization?

Determining the subcellular localization of YBR124W can provide crucial insights into its function. Based on studies of similar yeast proteins, the following protocol is recommended:

Construction of fluorescent protein fusions:

  • Create C-terminal GFP fusion using homologous recombination

  • Verify correct integration by PCR and sequencing

  • Test functionality by complementation in ΔYbr124w strain

Imaging protocol:

  • Grow cells to mid-log phase in appropriate medium

  • Apply stress conditions if desired (e.g., 5 mM MnSO4, 0.2 mM 2,4-dinitrophenol)

  • Image at multiple timepoints (0, 30, 60, 90 minutes)

  • Use fluorescence microscopy with appropriate filter sets (excitation 480 nm, emission 512-630 nm)

  • Co-stain with organelle markers to confirm localization:

    • DAPI for nucleus

    • MitoTracker for mitochondria

    • FM4-64 for vacuolar membrane

For quantitative analysis, measure the percentage of cells showing different localization patterns and the fluorescence intensity in different cellular compartments. Based on studies of other yeast proteins, prepare to distinguish between cytoplasmic, plasma membrane, nuclear, mitochondrial, ER, or vacuolar localization patterns, as CYSTM family proteins have been observed in various membrane compartments .

What bioinformatic approaches can predict potential functions of YBR124W?

Given the limited functional data for YBR124W, computational approaches can provide valuable guidance for experimental designs:

Sequence-based analysis:

  • BLAST searches against multiple databases to identify homologs

  • Multiple sequence alignment to identify conserved residues

  • Domain prediction using InterPro, SMART, and Pfam

  • Transmembrane topology prediction using TMHMM, Phobius

Structural prediction:

  • Secondary structure prediction using PSI-PRED

  • 3D structure modeling using AlphaFold2

  • Structural similarity searches using DALI

Functional association networks:

  • Protein-protein interaction prediction using STRING

  • Co-expression analysis with SPELL (Serial Pattern of Expression Levels Locator)

  • Genetic interaction networks from high-throughput studies

Evolutionary analysis:

  • Phylogenetic profiling to identify co-evolving genes

  • Ka/Ks ratio calculation to assess selective pressure

The amino acid sequence of YBR124W (119 aa) contains features suggesting it may be a membrane protein, with potential transmembrane regions . This is consistent with other uncharacterized yeast proteins that have been found to localize to various cellular membranes and play roles in stress responses .

How can microarray and RNA-Seq data be analyzed to identify conditions affecting YBR124W expression?

Microarray and RNA-Seq data analysis for YBR124W requires specific methodological considerations:

Data preprocessing steps:

  • Quality control of raw data

  • Background correction and normalization (typically log2 transformation)

  • Filtering for low expression probes

Differential expression analysis:

  • Identify conditions where YBR124W shows significant expression changes

  • Apply appropriate statistical tests (t-tests for simple comparisons, ANOVA for multiple conditions)

  • Use multiple testing correction (Benjamini-Hochberg FDR)

Co-expression analysis:

  • Calculate correlation coefficients between YBR124W and all other genes

  • Perform hierarchical clustering to identify gene clusters

  • Use gene set enrichment analysis to identify functional categories

When analyzing microarray data such as that shown for YBR124W (Red intensity: 92, Green intensity: 78) , calculate the log2 ratio:

log2(Red/Green) = log2(92/78) ≈ log2(1.18) ≈ 0.24

This slight positive value suggests minimal differential expression in the conditions tested. For RNA-Seq data, normalize counts using FPKM or TPM methods before comparative analysis.

What experimental designs can determine whether YBR124W has a role in stress responses like other CYSTM proteins?

Several yeast CYSTM proteins have been implicated in stress responses, particularly to heavy metals. To investigate if YBR124W shares this function, consider the following experimental design:

Expression system selection:

  • E. coli: BL21(DE3) strain is suitable for basic characterization

  • Yeast expression: Consider for potential post-translational modifications

  • Insect cells: For higher eukaryotic modifications if needed

Vector design considerations:

  • N-terminal His-tag for IMAC purification

  • Precision/TEV protease site for tag removal

  • Codon optimization for expression host

  • Signal sequence if secretion is desired

Expression optimization parameters:

  • Temperature: Test 16°C, 25°C, and 37°C

  • Induction: IPTG concentration (0.1-1.0 mM)

  • Time: 4h vs. overnight expression

  • Media: LB, TB, auto-induction media

Purification strategy:

  • First step: Ni-NTA affinity chromatography

  • Second step: Size exclusion chromatography

  • Buffer optimization: Include 6% trehalose to stabilize protein

  • Storage: Lyophilize or store at -80°C with 50% glycerol

Quality control should include SDS-PAGE analysis (>90% purity), mass spectrometry verification, and functional assays depending on predicted activities. For membrane proteins like YBR124W, consider detergent screening (DDM, LMNG, digitonin) to maintain native conformation during purification.

What functional genomics approaches can elucidate the role of YBR124W in yeast cellular processes?

Several cutting-edge functional genomics approaches can help characterize the role of YBR124W:

CRISPR-based screens:

  • CRISPRi for tunable repression of YBR124W

  • CRISPRa for overexpression studies

  • CRISPR-mediated homology-directed repair for precise mutations

Proteomics approaches:

  • BioID or TurboID proximity labeling to identify interacting proteins

  • SILAC or TMT labeling to quantify proteome changes in ΔYbr124w

  • Phosphoproteomics to identify signaling pathways affected

Metabolomics integration:

  • Targeted metabolite analysis in wild-type vs. ΔYbr124w

  • Fluxomics using 13C-labeled substrates to track metabolic changes

Systems biology integration:

  • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

  • Network analysis to position YBR124W in cellular pathways

  • Flux balance analysis to predict metabolic impacts

For yeast stress studies, continuous culture approaches using chemostats offer precise control of growth conditions. Consider the following setup:

  • 0.5 L reactor with 0.35 L working volume

  • Temperature: 28°C

  • pH: 3.3 (controlled by automatic addition of 2 M NaOH)

  • Stirring: 300 rpm

  • Dilution rate (D): 0.2 h-1

This approach allows for steady-state measurements of biomass and metabolic parameters under tightly controlled conditions, enabling detection of subtle phenotypic differences between wild-type and ΔYbr124w strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.