Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR209W (YBR209W)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

YBR209W is recombinantly expressed in E. coli and purified for research use. Key production details include:

ParameterDetails
Source OrganismE. coli
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
ApplicationsSDS-PAGE, protein interaction studies, genetic screens

Genetic and Evolutionary Context

  • Conservation: Widely conserved across S. cerevisiae strains but lacks homologs in other species .

  • Neutral Locus: Used as a genomic insertion site in CRISPR/Cas9-based genetic interaction studies due to its non-essential nature .

Experimental Applications

YBR209W has been leveraged in high-throughput genetic screens:

  • Protein Interaction Studies: Serves as a neutral control in screens for protein-protein interactions (PPIs) using methotrexate (MTX) selection .

  • Genetic Interaction (GI) Mapping: Used to integrate barcoded guide RNAs (gRNAs) for pooled fitness assays to identify piQTLs (protein interaction quantitative trait loci) .

Current Research Gaps and Future Directions

  • Functional Elucidation: No GO annotations or subcellular localization data are available; all localization studies report “–” for all stages .

  • Structural Studies: The protein’s tertiary structure and potential domains remain uncharacterized.

  • Biological Relevance: Potential roles in stress response, metabolism, or chromatin dynamics require experimental validation.

Key Research Implications

  • Genetic Engineering: Its non-essential status makes it ideal for genomic modifications without phenotypic disruption .

  • Control in Experiments: Used as a negative control in screens to isolate true positives/negatives .

  • Therapeutic Potential: Unexplored, but conserved sequences may hint at evolutionary significance .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on your purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development if feasible.
Synonyms
YBR209W; YBR1451; Uncharacterized protein YBR209W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR209W
Target Protein Sequence
MNAYWFHYRASIKKEAPNYKRTFLGRARNAFLLILSEAYLLFVFLSYLIRGKSLEKRVND EAKCSQRCVPLQLANNLAFGDRHKRSANFKKGIANTHSSLICSKP
Uniprot No.

Target Background

Database Links

STRING: 4932.YBR209W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YBR209W and why is it significant in yeast genetics?

YBR209W is a putative uncharacterized protein in Saccharomyces cerevisiae that spans 318 base pairs as mRNA and encodes a 105 amino acid protein. Despite being conserved across S. cerevisiae strains, it is classified as a non-essential gene, meaning the yeast can survive without it. The protein contains one transmembrane domain according to structural predictions .

The significance of YBR209W in modern yeast genetics lies not primarily in the protein's function (which remains largely uncharacterized) but in the utility of its genomic locus. The YBR209W open reading frame has become a widely used neutral integration site for various genetic constructs in S. cerevisiae, making it valuable for genetic engineering applications in yeast research .

What genomic features characterize the YBR209W locus?

The YBR209W gene is identified by NCBI Gene ID 852508 and SGD ID S000000413. It is located on chromosome II of the S. cerevisiae genome. The gene contains a single exon spanning positions 1-318 with no introns in its natural state. The protein has similarity to the SwissProt entry YB59_YEAST (Uncharacterized protein YBR209W) with an e-value of 2.12629e-56, indicating strong sequence similarity .

The genomic location of YBR209W has been determined to be relatively "neutral" for integration, meaning that modifications at this site typically have minimal impact on cellular fitness and physiology. This neutrality makes it an ideal target for genomic engineering when researchers want to introduce new genetic elements without disrupting essential cellular functions .

How does YBR209W differ across various S. cerevisiae strains?

While YBR209W is conserved across S. cerevisiae strains, there may be subtle sequence variations. The protein is consistently annotated as non-essential across different genetic backgrounds. Research involving clinical and laboratory strains of S. cerevisiae (such as BY and 3S strains) has utilized the YBR209W locus for genetic modifications without apparent strain-specific complications .

The conservation of YBR209W across S. cerevisiae strains, including diverse isolates from clinical and environmental sources, suggests that any natural polymorphisms in this gene do not significantly impact fitness in various environments. This conservation further validates its use as a neutral integration site across different genetic backgrounds .

Why is the YBR209W locus commonly used for genomic integration in yeast?

The YBR209W locus has become a preferred site for genomic integration in S. cerevisiae for several key reasons:

  • Neutrality: Modifications at this locus typically have minimal impact on cellular fitness and physiology, making it ideal for introducing genetic constructs without confounding effects .

  • Accessibility: The genomic location is relatively accessible for integration events, with good transformation efficiency.

  • Established protocols: Multiple research groups have developed and published protocols for integration at this site, creating a well-established methodology in the field .

  • Versatility: The locus has been successfully used for integrating various genetic elements, including gRNAs for CRISPR systems, barcode sequences for lineage tracking, and complete gene libraries .

The consistent use of this locus across different experimental systems also facilitates comparison between studies, allowing researchers to build upon existing knowledge without introducing additional variables related to integration location .

What genetic elements are typically integrated at the YBR209W locus?

Research shows that the YBR209W locus has been used to integrate a diverse array of genetic elements:

  • Guide RNAs (gRNAs) for CRISPR interference (CRISPRi) systems, allowing for inducible gene knockdown experiments .

  • DNA barcodes for lineage tracking in evolution experiments and pooled genetic screens .

  • Selective markers such as partial URA3 sequences combined with loxP recombination sites for strain construction .

  • Inducible expression systems, such as galactose-inducible Cre recombinase genes .

  • Complete intron-containing gene libraries for splicing regulation studies .

The flexibility of this locus for accommodating diverse genetic elements makes it particularly valuable for complex experimental designs requiring stable genomic integration .

What integration methods are most effective for targeting the YBR209W locus?

Several integration methods have proven effective for targeting the YBR209W locus in S. cerevisiae:

  • Cre-Lox Recombination System: Particularly useful for high-throughput applications, this approach utilizes strategically placed loxP variant sites (such as lox66 and lox71) at the YBR209W locus and on incoming DNA. When combined with galactose-inducible Cre recombinase expression, this system enables efficient site-specific recombination .

  • CRISPR-Cas9 Mediated Integration: Using guide RNAs targeting the YBR209W locus along with homology arms flanking the integration construct facilitates precise integration through homology-directed repair following Cas9-induced double-strand breaks .

  • Homologous Recombination: Traditional yeast transformation methods using extended homology regions (typically 500bp or more) flanking the YBR209W locus provide reliable integration, though at lower efficiency than CRISPR-assisted methods .

For high-throughput applications, researchers have successfully employed methods that combine the YBR209W integration with selection markers and barcoding strategies, enabling the parallel construction and tracking of thousands of strains simultaneously .

How should researchers design constructs for optimal integration at the YBR209W locus?

When designing constructs for integration at the YBR209W locus, researchers should consider several key factors:

  • Homology Arms: Include sufficient homology to the YBR209W locus (typically 40-500bp depending on method) flanking your construct. Longer homology arms generally improve integration efficiency but increase construct size .

  • Selectable Markers: Incorporate appropriate selection markers to identify successful integrants. In some designs, split markers (such as 5' and 3' fragments of URA3) have been used successfully, requiring recombination for functional expression .

  • Recombination Sites: For Cre-Lox based methods, incorporate appropriate loxP variant sites (e.g., lox66, lox71, lox2272) that ensure directional integration and prevent undesired recombination events .

  • Inducible Systems: Consider including inducible elements (like galactose-inducible promoters) to control the timing of construct expression, which can be especially important for toxic or fitness-affecting elements .

  • Barcoding Strategies: For pooled experiments, incorporate unique DNA barcodes that can be amplified and sequenced to track individual strains. The barcode should be designed to be compatible with your sequencing strategy .

Construct design should also account for the specific requirements of your experiment, such as expression levels needed, temporal control requirements, and compatibility with downstream analysis methods .

What controls should be included when using YBR209W for genetic integration experiments?

When conducting experiments with constructs integrated at the YBR209W locus, several controls are essential:

  • Empty Vector Control: Strains with only the selection marker integrated at the YBR209W locus, without the experimental construct, provide a baseline for assessing the impact of integration itself .

  • No-Gene Knockdown Controls: For CRISPRi experiments, include strains with non-targeting guide RNAs to control for potential off-target effects of the CRISPR machinery .

  • Single Modification Controls: When studying interactions between multiple genetic elements, include strains with each individual modification to distinguish combinatorial effects from single-element effects .

  • Parental Strain Comparisons: Maintain and test the original unmodified strain alongside your engineered strains to quantify the full impact of genetic modifications .

  • Cross-Locus Controls: In some cases, integrating the same construct at an alternative genomic locus can help distinguish locus-specific effects from construct-specific effects .

Research groups have successfully implemented these controls in high-throughput formats, with studies incorporating hundreds of control strains alongside thousands of experimental strains .

What phenotypic assays are most informative when studying strains with YBR209W modifications?

When evaluating strains with constructs integrated at the YBR209W locus, several phenotypic assays have proven particularly informative:

  • Competitive Growth Assays: Pooled growth of barcoded strains followed by barcode sequencing (BarSeq) allows quantitative measurement of relative fitness across hundreds or thousands of strains simultaneously .

  • Gene Expression Analysis: RNA-seq or qPCR to measure changes in gene expression patterns resulting from integrated regulatory elements or knockdown constructs .

  • Protein Function Assays: For protein-coding genes integrated at YBR209W, specific assays targeting the expected function (enzymatic activity, protein-protein interactions, etc.) should be employed .

  • Environmental Stress Responses: Testing growth under various stress conditions (temperature variation, nutrient limitation, chemical stressors) can reveal condition-specific effects of genetic modifications .

  • In vivo Persistence Assays: For studies related to pathogenicity or host interaction, modified yeast strains can be tested for persistence in model organisms such as mice, with organ-specific colonization measured by barcode sequencing .

The choice of phenotypic assays should be guided by the specific research question and the nature of the genetic modifications introduced at the YBR209W locus .

What are common challenges when integrating constructs at the YBR209W locus and how can they be addressed?

Researchers commonly encounter several challenges when working with the YBR209W locus:

  • Low Integration Efficiency: This can be addressed by:

    • Increasing homology arm length (up to 500bp)

    • Using CRISPR-Cas9 to create double-strand breaks at the integration site

    • Optimizing transformation protocols with extended recovery periods

    • Employing high-efficiency yeast transformation methods with PEG/LiAc

  • Off-Target Integration: Minimize by:

    • Conducting PCR verification of correct integration using primers spanning the junction regions

    • Performing whole-genome sequencing on key strains to confirm single integration

    • Using unique sequence designs that reduce homology to other genomic regions

  • Expression Variability: Reduce by:

    • Including insulator sequences to buffer position effects

    • Using well-characterized synthetic promoters with low noise characteristics

    • Implementing inducible systems with tight regulation

  • Clone Competition During Library Construction: Mitigate by:

    • Maintaining high transformation efficiency and coverage (>10x library size)

    • Minimizing growth steps between transformation and final application

    • Using unique barcodes to track individual clones

  • Recombination Between Repeated Sequences: Prevent by:

    • Using codon-optimized or sequence-diversified repeats

    • Employing different loxP variant sites (lox66, lox71, lox2272) that preferentially recombine with their specific partners

Careful experimental design and rigorous validation of integration events are essential for overcoming these challenges .

How can researchers optimize barcode sequencing for tracking YBR209W-integrated constructs?

Optimizing barcode sequencing for strains with constructs integrated at YBR209W involves several key considerations:

  • Barcode Design:

    • Use barcodes of sufficient length (typically 15-25 nucleotides) to ensure adequate diversity

    • Incorporate error-correcting features in barcode design to distinguish sequencing errors from true variants

    • Ensure barcodes maintain balanced GC content and avoid homopolymer stretches

  • Amplification Strategy:

    • Design primers targeting constant regions flanking the barcode

    • Include unique molecular identifiers (UMIs) to control for PCR amplification bias

    • Use high-fidelity polymerases to minimize PCR-introduced errors

  • Sequencing Approach:

    • Maintain sufficient sequencing depth (typically >100 reads per barcode) for reliable quantification

    • Implement appropriate clustering algorithms (e.g., Bartender v1.1) to correct for sequencing errors

    • Filter low-coverage timepoints and spurious barcodes appearing in single timepoints

  • Data Analysis Pipeline:

    • Filter raw count data to remove low-confidence measurements

    • Normalize counts to account for sequencing depth variations between samples

    • Apply appropriate statistical models to infer strain fitness from frequency changes over time

Researchers have successfully used these approaches to track thousands of barcoded strains simultaneously, allowing for high-resolution fitness measurements and genetic interaction mapping .

What methods are most effective for validating successful integration at the YBR209W locus?

Multiple validation methods should be employed to confirm successful integration at the YBR209W locus:

  • PCR Verification:

    • Use primers spanning the integration junctions (one primer in the genome, one in the insert)

    • Amplify the entire integrated region to confirm expected size

    • Sequence PCR products to verify precise integration without mutations

  • Functional Validation:

    • Test for expression of integrated marker genes or reporters

    • Confirm induced expression/repression responds as expected to environmental cues (e.g., galactose induction)

    • Validate that integrated guide RNAs produce expected knockdown phenotypes

  • Growth-Based Selection:

    • Utilize appropriate selective media based on integrated markers

    • Perform replica plating to confirm stable maintenance of the integrated construct

    • Test for auxotrophic complementation if relevant markers are used

  • Next-Generation Sequencing:

    • Targeted amplicon sequencing of the integration site

    • Whole-genome sequencing for critical strains to confirm single integration

    • RNA-seq to verify expression of integrated constructs when applicable

  • Southern Blotting:

    • For complex or repetitive constructs where PCR might be unreliable

    • Provides confirmation of single vs. multiple integration events

    • Helps detect potential genome rearrangements

The combination of these approaches provides robust validation of integration events, which is particularly important for experiments relying on precise genetic modifications .

How has the YBR209W locus been used in genetic interaction mapping?

The YBR209W locus has been instrumental in developing high-throughput methods for mapping genetic interactions in yeast:

  • CRISPRiSeq Approach: Researchers developed a CRISPRi-based method utilizing the YBR209W locus for guide RNA integration to systematically assay approximately 7,700 gene pairs for genetic interactions. This approach enabled the creation of double knockdown strains through a clever design where:

    • The YBR209W locus contained one guide RNA and half of a selectable marker

    • Query plasmids contained a second guide RNA, a unique barcode, and the complementary half of the selectable marker

    • Cre-Lox recombination facilitated high-throughput strain construction

  • Experimental Design: The study generated over 17,000 double CRISPRi strains, including 15,200 double-gene knockdowns and appropriate controls. Each strain could be uniquely identified by sequencing amplicons of the YBR209W guide locus, which contained both the guide RNA sequence and a DNA barcode .

  • Data Analysis: Researchers developed computational methods to identify genetic interactions from pooled growth data, allowing for the identification of both negative (synthetic lethal/sick) and positive (suppressive) genetic interactions .

This approach demonstrated significant advantages over previous genetic interaction mapping methods, including improved scalability, reduced cost, and the ability to study essential genes through partial knockdown .

What role has the YBR209W locus played in studying splicing regulation in yeast?

The YBR209W locus has been utilized as an integration site for studying the complex mechanisms of splicing regulation in S. cerevisiae:

  • Library Integration Approach: Researchers created a large library of intron-containing gene variants and integrated them at the YBR209W locus. This approach allowed for:

    • Systematic mutation of splice sites and regulatory elements

    • High-throughput assessment of splicing efficiency

    • Controlled expression from a synthetic promoter with high expression and low noise characteristics

  • Experimental Design: The entire intron-containing gene library was integrated into the YBR209W open reading frame using a Cre-Lox based method. This design ensured that all variants were expressed from the same genomic context, eliminating position effects that might confound splicing efficiency measurements .

  • Results and Impact: This approach enabled a comprehensive analysis of splicing regulation, revealing the complex interplay between different splicing signals and regulatory elements. The findings provided insights into the sequence requirements for efficient splicing and the evolutionary constraints on intron sequences .

The use of the YBR209W locus for this application highlights its utility for integrating complex libraries and studying fundamental biological processes in a controlled genomic context .

What emerging technologies might enhance the utility of the YBR209W locus in yeast research?

Several emerging technologies hold promise for further enhancing the utility of the YBR209W locus:

  • Base Editing and Prime Editing: These CRISPR derivatives enable precise nucleotide changes without double-strand breaks and could facilitate more efficient and scarless integration at the YBR209W locus, potentially improving integration efficiency and reducing off-target effects .

  • Single-Cell Sequencing Integration: Combining YBR209W-integrated barcodes with single-cell RNA-seq could enable tracking of individual strain transcriptomes in mixed populations, providing unprecedented resolution for studying heterogeneous responses to environmental conditions .

  • Biosensor Integration: The YBR209W locus could serve as an integration site for genetically encoded biosensors that report on cellular metabolic states, stress responses, or protein-protein interactions, expanding the range of phenotypes that can be monitored in high-throughput screens .

  • Orthogonal Regulation Systems: Integration of orthogonal transcription factors and their corresponding response elements at YBR209W could enable sophisticated genetic circuits with minimal crosstalk with endogenous regulatory networks .

These technological advances could further expand the already diverse applications of the YBR209W locus in yeast research, enabling new experimental designs and insights into fundamental biological processes .

What are the current limitations in our understanding of the native YBR209W protein function?

Despite the extensive use of the YBR209W locus for genetic engineering, our understanding of the native protein's function remains limited:

  • Functional Annotation Gaps: YBR209W is currently annotated as an uncharacterized protein, with no assigned molecular function, biological process, or cellular component in standard ontologies. Key questions remain about:

    • Its potential enzymatic activities or binding partners

    • Its subcellular localization and trafficking

    • Its expression patterns under different conditions

  • Structural Features: While computational analysis predicts a single transmembrane domain, comprehensive structural characterization is lacking. We don't know:

    • The protein's three-dimensional structure

    • Whether it forms complexes with other proteins

    • If it undergoes post-translational modifications

  • Evolutionary Conservation: Though YBR209W is conserved across S. cerevisiae strains, its deeper evolutionary relationships and potential homologs in other species remain poorly characterized .

  • Physiological Context: Given that YBR209W is non-essential, its contribution to fitness under specific environmental conditions or stress situations remains to be systematically explored .

Addressing these knowledge gaps would provide a more complete understanding of YBR209W beyond its utility as a genomic integration site .

How might characterization of the native YBR209W function impact its use as an integration site?

Further characterization of the native YBR209W protein could have several implications for its continued use as an integration site:

  • Context-Dependent Effects: If YBR209W proves to have important functions under specific conditions not yet tested, disruption of this gene might have previously unrecognized phenotypic consequences in those contexts. Researchers would need to:

    • Validate the "neutrality" of YBR209W disruption under their specific experimental conditions

    • Consider alternative integration sites for studies involving conditions where YBR209W might play a role

  • Potential Regulatory Insights: Understanding the native regulation of the YBR209W locus could reveal:

    • Useful regulatory elements that could be repurposed for controlled expression of integrated constructs

    • Potential interference between native regulatory mechanisms and introduced genetic elements

    • Conditions under which the locus might be more or less accessible for integration

  • Comparative Genomics Applications: If YBR209W has functional homologs in other species, this knowledge could:

    • Facilitate the identification of equivalent "neutral" integration sites in other organisms

    • Enable cross-species studies with comparable genetic manipulations

    • Provide evolutionary context for interpreting results from YBR209W-based experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.