Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR232C (YBR232C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
YBR232C; YBR1530; Putative uncharacterized protein YBR232C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR232C
Target Protein Sequence
MFILAEVSDFILDIVAPLCPTISEACLTKHSIRKCTSEGTLSGESWSLSEWLSASFRATR LISASSCSSLVSSPFFLLSVLGETSTVVGVVVIDGFVVSVDIIELKSITERLFNAALDD
Uniprot No.

Target Background

Database Links

STRING: 4932.YBR232C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the genetic sequence and location of YBR232C?

YBR232C is an uncharacterized gene in the Saccharomyces cerevisiae genome. The gene is located on chromosome II, as indicated by the "B" in its systematic name. The reference genome sequence for S. cerevisiae is derived from the laboratory strain S288C, which serves as the standard for genetic analysis of this organism . To analyze this gene in your research, various bioinformatic tools are available through databases such as the Saccharomyces Genome Database (SGD), including BLASTN, BLASTP, primer design tools, and restriction fragment mapping options .

What biological processes might YBR232C be involved in?

While the specific function of YBR232C remains to be fully characterized, research on other uncharacterized yeast genes provides methodological frameworks for investigation. For example, studies of the uncharacterized gene YBR238C revealed its involvement in regulating lifespan and mitochondrial function . To determine potential biological processes for YBR232C, researchers should consider:

  • Conducting systematic comparison of genesets that show similar expression patterns or deletion phenotypes

  • Performing transcriptomics analysis under various conditions

  • Analyzing protein localization using GFP tagging experiments

  • Assessing chronological and replicative lifespan in deletion mutants

How can researchers obtain and verify YBR232C deletion strains?

To obtain YBR232C deletion strains, researchers can access the systematic deletion collection available through resources like the Saccharomyces Genome Database. Verification of the deletion should include:

  • PCR confirmation using primers flanking the deletion cassette

  • Sequencing of the junction regions to confirm precise replacement

  • Complementation studies to verify that phenotypes are directly attributed to the gene deletion

  • Quantitative reverse transcription-PCR (qRT-PCR) to confirm absence of transcript

What experimental controls are essential when studying YBR232C function?

When investigating an uncharacterized gene like YBR232C, proper experimental controls are critical. Based on methodologies used in similar studies, essential controls include:

  • Using multiple genetic backgrounds (e.g., BY4743 and CEN.PK strains) to account for strain-specific effects

  • Including isogenic wild-type strains grown under identical conditions

  • Performing experiments in different media compositions to assess nutrient-dependent effects

  • Including both positive and negative controls for phenotypic assays

  • Implementing time-course experiments to capture temporal effects

How might YBR232C relate to cellular aging pathways in yeast?

Research on uncharacterized yeast genes has revealed important connections to aging pathways. For example, YBR238C deletion increases both chronological lifespan (CLS) and replicative lifespan (RLS), suggesting involvement in aging regulation . To investigate YBR232C's potential role in aging:

  • Measure CLS using outgrowth survival methods as performed for YBR238C, tracking cell viability over time in stationary phase cultures

  • Assess RLS by counting daughter cells produced by individual mother cells

  • Investigate genetic interactions with known aging pathway components, particularly the Target of Rapamycin Complex 1 (TORC1) pathway

  • Examine survivability under caloric restriction and rapamycin treatment conditions

What transcriptomic signatures might reveal YBR232C function?

Transcriptomic analysis represents a powerful approach to understanding gene function. Based on methodologies applied to similar uncharacterized genes:

  • Compare wild-type and ybr232c∆ mutant transcriptomes under multiple conditions

  • Perform functional enrichment analysis to identify biological processes affected by deletion

  • Analyze MCODE complexes based on ontology-enriched terms

  • Compare expression profiles with those of rapamycin-treated cells to identify potential connections to TORC1 signaling

A similar approach for YBR238C revealed 326 upregulated and 61 downregulated genes, with significant enrichment in metabolic pathways, demonstrating the power of this methodology for functional characterization .

How can researchers determine if YBR232C affects mitochondrial function?

Given that other uncharacterized yeast genes like YBR238C have shown connections to mitochondrial function, researchers investigating YBR232C should consider:

  • Measuring adenosine triphosphate (ATP) levels in wild-type versus deletion strains

  • Quantifying reactive oxygen species (ROS) production using fluorescent probes

  • Assessing mitochondrial morphology through microscopy with mitochondria-specific dyes

  • Measuring oxygen consumption rates as an indicator of respiratory capacity

  • Analyzing expression of nuclear-encoded mitochondrial genes (e.g., HAP4)

What methodologies are appropriate for investigating protein-protein interactions involving YBR232C?

To elucidate the interaction network of YBR232C:

  • Perform yeast two-hybrid screening to identify direct protein interaction partners

  • Conduct co-immunoprecipitation followed by mass spectrometry for in vivo interaction verification

  • Implement Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in living cells

  • Analyze synthetic genetic interactions using systematic genetic interaction mapping

  • Utilize protein complementation assays to validate specific interactions

What protein domains are predicted in YBR232C?

While specific information about YBR232C domains is limited in the search results, approaches used for other uncharacterized yeast proteins can be applied:

  • Perform sequence architecture analysis using tools like ANNOTATOR to identify structured and unstructured regions

  • Apply HHpred for distant homology detection and structure prediction

  • Identify potential functional domains through comparative genomics with related yeast species

  • Assess conservation patterns across fungal species using BLASTP versus fungi databases

How can researchers predict the subcellular localization of YBR232C?

To determine the subcellular localization of YBR232C:

  • Analyze existing high-throughput localization studies that may include YBR232C data

  • Implement GFP tagging at either N- or C-terminus for direct visualization

  • Perform cellular fractionation followed by western blotting to detect the native protein

  • Use computational prediction tools that analyze targeting sequences

  • Compare with GO Cellular Component annotations from existing databases

What are the most effective experimental approaches for functional characterization of YBR232C?

Based on successful approaches to other uncharacterized yeast genes, researchers should consider:

  • Genetic approach: Generate and phenotype deletion and overexpression strains

  • Biochemical approach: Purify the protein and identify binding partners or substrates

  • Physiological approach: Measure metabolic parameters in mutant vs. wild-type strains

  • Transcriptomic approach: Identify genes with altered expression in ybr232c∆ mutants

  • High-throughput approach: Screen for genetic interactions using synthetic genetic arrays

How should researchers design experiments to detect subtle phenotypes in YBR232C mutants?

Uncharacterized genes often exhibit subtle phenotypes that require specialized detection methods:

  • Employ competitive growth assays with wild-type and mutant strains labeled with different fluorescent markers

  • Perform stress challenge experiments using multiple stressors (oxidative, heat, osmotic)

  • Utilize high-sensitivity metabolomic approaches to detect subtle metabolic changes

  • Implement microfluidic single-cell analysis to capture cell-to-cell variation

  • Design long-term experiments that can detect cumulative phenotypic effects

What transcriptomic analysis approaches provide the most insight into YBR232C function?

For optimal transcriptomic analysis:

  • Compare expression profiles under multiple conditions (log phase, stationary phase, nutrient limitation)

  • Apply both differential expression analysis and co-expression network approaches

  • Implement time-course experiments to capture dynamic expression changes

  • Analyze data using multiple normalization methods to ensure robust findings

  • Validate key findings using qRT-PCR on selected target genes

How conserved is YBR232C across fungal species?

To assess evolutionary conservation:

  • Perform sequence similarity searches across fungal genomes using tools available through SGD

  • Analyze synteny patterns to identify positional conservation

  • Conduct phylogenetic analysis to determine evolutionary relationships

  • Examine selection pressure through Ka/Ks ratio analysis

  • Compare functional annotations of orthologs in other fungal species

Are there functional analogs of YBR232C in higher eukaryotes?

While the search results don't directly address YBR232C analogs in higher eukaryotes, the approach can be modeled after studies of other yeast genes:

  • Identify potential orthologs through reciprocal BLAST searches

  • Analyze domain architecture conservation across species

  • Assess functional complementation by expressing mammalian genes in yeast deletion strains

  • Examine conservation of interaction partners across species

  • Compare phenotypes of mutants in model organisms with those in yeast

How should researchers interpret contradictory phenotypic data for YBR232C mutants?

When facing contradictory results:

  • Systematically evaluate strain background effects that may explain differences

  • Consider environmental variables (media composition, temperature, growth phase)

  • Assess technical differences in measurement methodologies

  • Implement biological replicates across multiple independent experiments

  • Consider genetic background suppressors that may mask phenotypes in certain strains

What statistical approaches are most appropriate for analyzing subtle phenotypic differences in YBR232C studies?

For robust statistical analysis:

  • Use appropriate sample sizes based on power calculations

  • Implement both parametric and non-parametric statistical tests

  • Consider longitudinal data analysis for time-course experiments

  • Apply multiple testing correction for genome-wide studies

  • Utilize Bayesian approaches for integrating multiple data types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.