Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR300C (YBR300C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YBR300C; YBR2120; Putative uncharacterized protein YBR300C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR300C
Target Protein Sequence
MAATPAAIEVSLTIVFVLFFSADVSLTRNSEMKAHTSKMDSYSSSIYMNVLPTSLAQTSY HLAPISHLKCLSVQFSSHIHYSYYYGASVLERCVFHRSRIRGARFIVPIPFIAFPRHKNV FSQCTYFRRIPLGCLQRCSCSFWPRKSQNQICFEPSLRGHLIFVL
Uniprot No.

Target Background

Database Links

STRING: 4932.YBR300C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is YBR300C and what is currently known about its molecular function?

    YBR300C is a putative uncharacterized protein in Saccharomyces cerevisiae. Despite being identified in the yeast genome, its precise molecular function remains largely unknown. Research suggests it may have effects that became apparent when studying deletion strains, but these effects were complicated by second-site mutations within newly generated YBR300C deletion strains . When investigating uncharacterized proteins like YBR300C, researchers should employ multiple complementary approaches including phenotypic analysis, transcriptomic profiling, and genetic interaction studies to elucidate function.

  • What are the recommended methods for generating YBR300C deletion strains?

    To generate reliable YBR300C deletion strains, researchers should follow established yeast gene disruption protocols with important modifications to avoid second-site mutations. The recommended approach involves:

    • Using Yeast-Mediated Ligation (YML) for precise gene replacement

    • Confirming disruption via PCR using primers such as F-FUM1(63U) and R-FUM1(86D)

    • Extracting genomic DNA following protocols like those described by Laemmli (1970)

    • Validating deletion with multiple primer sets to ensure specificity

    • Creating at least two independent deletions for each strain to control for second-site mutations

    When studying YBR300C specifically, researchers should be aware that previous studies found effects caused by second-site mutations within the YBR300C deletion strain, necessitating careful validation .

  • How should researchers design experiments to phenotypically characterize YBR300C mutants?

    For robust phenotypic characterization of YBR300C mutants, implement a systematic experimental design that:

    • Uses reciprocal hemizygosity tests to distinguish effects of the gene itself versus second-site mutations

    • Employs a linear model for statistical analysis: yi = μ + H + R + ε, where yi is the phenotype of strain i, μ is the average phenotype, H is the type of hemizygote, R represents replicates, and ε is error

    • Randomizes strain positions across plates to control for position effects

    • Takes multiple measurements from different orientations to control for subtle trends in colony appearance

    • Applies ANOVA to test for significant differences between reciprocal hemizygotes

    • Includes appropriate wild-type and marker controls

    This approach helps distinguish gene-specific effects from background variations and second-site mutations that have confounded previous YBR300C studies.

Advanced Research Questions

  • What strategies can address the challenge of second-site mutations when studying YBR300C?

    Second-site mutations have significantly complicated YBR300C research, as noted in published studies where "YBR300C was found to have effects caused by a second-site mutation within the newly generated YBR300C deletion strain" . To address this challenge:

    • Implement a noncomplementation screen methodology similar to that described for quantitative trait alleles

    • Create and analyze multiple independent deletion strains

    • Utilize reciprocal hemizygosity testing by crossing the deletion strain with a wild-type strain from a different genetic background

    • Apply analysis of variance using the model: yi = μ + H + R + ε

    • Sequence the entire genome of deletion strains to identify any unintended mutations

    • Perform complementation tests with wild-type YBR300C to confirm phenotypes are specifically related to its absence

    • Consider CRISPR-Cas9 methods for more precise gene editing with fewer off-target effects

  • How can transcriptomic approaches be applied to elucidate YBR300C function?

    Transcriptomic analysis offers powerful insights into uncharacterized proteins like YBR300C. Implementation should include:

    • Chemostat cultivation to ensure steady-state conditions and reproducible gene expression

    • Sampling and probe preparation for microarray analysis as described in previous studies

    • Application of appropriate filtering and normalization methods (e.g., global scaling to a target value of 150)

    • Conducting pairwise comparisons between different cultivation conditions, focusing on conditions that differ in single parameters

    • Setting significance thresholds (typically fold change ≥2 with false discovery rate ≤1%)

    • Cross-referencing expression data with upstream sequence analysis to identify regulatory motifs

    • Correlating expression patterns with known stress response networks and transcription factors

    This approach has proven valuable for understanding gene function in previous studies where "52% of the genome exhibited significantly different transcript levels in at least one pairwise comparison" , potentially placing YBR300C in functional context.

  • What bioinformatic approaches are most effective for predicting potential functions of YBR300C?

    For uncharacterized proteins like YBR300C, comprehensive bioinformatic analysis should include:

    • Sequence homology searches against multiple databases

    • Secondary structure prediction and domain identification

    • Phylogenetic analysis to identify orthologs in other species

    • Promoter analysis to identify regulatory elements

    • Protein-protein interaction network prediction

    • Analysis using specialized tools like SignalP-5.0 to check for secretion signal peptides

    • Integration with transcriptomic data to identify co-expressed genes

    • GO (Gene Ontology) enrichment analysis to identify potential biological processes

    These methods can place YBR300C in biological context and generate testable hypotheses about its function, enabling focused experimental validation.

  • How might YBR300C contribute to stress response pathways in S. cerevisiae?

    While YBR300C's precise role remains uncharacterized, its potential involvement in stress response mechanisms warrants investigation:

    • Conduct growth assays under various stressors (temperature variation, osmotic stress, oxidative stress)

    • Analyze transcriptomic data to determine if YBR300C expression changes during stress conditions

    • Investigate potential relationships with known stress response transcription factors such as Msn2p, Msn4p, and Yap1p

    • Examine potential connections to known stress response pathways like the HOG pathway

    • Test for genetic interactions with genes encoding 3-methyladenine DNA glycosylase and MEC1 (a phospho-inositol kinase-related protein)

    • Differentiate between transient and sustained stress responses under steady-state conditions

    As noted in stress response research, "global stress responses tend to evoke a transient, large-scale shift in transcription" , making it important to distinguish between immediate and long-term effects in the study of YBR300C.

  • What experimental design is most appropriate for investigating genetic interactions of YBR300C?

    To comprehensively map genetic interactions of YBR300C:

    Design ElementImplementation
    Study DesignFull factorial design with multiple factors (e.g., genetic background, environmental conditions)
    Control GroupsInclude single deletion strains, wild-type, and marker controls
    ReplicationMinimum three independent biological replicates
    RandomizationRandomize strain positions to control for position effects
    Statistical AnalysisANOVA with appropriate post-hoc tests
    ValidationCross-validation with reciprocal hemizygosity tests

    This approach allows for systematic investigation of both additive and synergistic effects between YBR300C and other genes, potentially revealing functional relationships and compensatory mechanisms.

  • How can researchers distinguish between direct effects of YBR300C deletion and broader genetic background effects?

    Distinguishing direct gene effects from background variation requires:

    • Implementing reciprocal hemizygosity tests as described in quantitative trait allele research

    • Creating YBR300C deletions in multiple strain backgrounds (e.g., BY4741, BY4742, BY4743, and other S. cerevisiae strains such as YJF173)

    • Crossing deletion strains with different genetic backgrounds and analyzing diploid progeny

    • Applying statistical models that account for genetic background: yi = μ + H + B + H×B + ε, where B represents genetic background effects

    • Measuring multiple phenotypes rather than relying on a single trait

    • Comparing results with datasets from genome-wide deletion studies

    This methodology has successfully identified genes like TUS1 and RBK1 that showed effects caused by second-site mutations, similar to what was observed with YBR300C .

  • What are the most effective expression systems for producing recombinant YBR300C protein for biochemical characterization?

    For optimal recombinant YBR300C production and characterization:

    • Select appropriate expression vectors such as pBBH1 for intracellular expression or pBBH4 for extracellular secretion (which carries the XYNSEC signal)

    • Linearize vectors with appropriate restriction enzymes (e.g., EcoRI/XhoI for pBBH1, NruI/XhoI for pBBH4)

    • Use Yeast-Mediated Ligation (YML) and electroporation for cloning and transformation

    • Consider auxotrophic S. cerevisiae strains like Y11030 or Y294 as host organisms

    • Design primers with appropriate restriction sites for subcloning

    • Analyze predicted amino acid sequences with tools like SignalP-5.0 to confirm presence/absence of secretion signals

    • Optimize culture conditions for protein expression (temperature, media composition, induction timing)

    • Develop purification strategies based on predicted protein properties

  • How can vaccine development research inform approaches to studying YBR300C?

    Vaccine development studies using S. cerevisiae provide methodological insights applicable to YBR300C research:

    • S. cerevisiae can be engineered to express foreign antigens and tumor-associated antigens

    • Heat-killed recombinant yeast preparations maintain immunological activity

    • Yeast vehicles induce both CD4+ and CD8+ T-cell responses through cross-presentation

    • Multiple site administration induces stronger responses than single-site delivery

    • Repeated administration causes increased antigen-specific responses

    These principles can be adapted to study YBR300C by creating recombinant strains expressing tagged versions of the protein, potentially providing insights into its cellular localization, trafficking, and interactions with the host immune system if used in in vivo studies.

  • What is the significance of temperature sensitivity in characterizing YBR300C function?

    Temperature sensitivity studies may provide critical insights into YBR300C function:

    • Research on genes required for growth at low temperatures has identified only two enriched processes: "dynein/dynactin machinery and biosynthesis of threonine"

    • Design experiments to test YBR300C deletion strains at varied temperatures (10°C, 15°C, 30°C, 37°C)

    • Analyze growth rates, morphology, and molecular phenotypes across temperature gradients

    • Compare transcriptomic profiles of wild-type and YBR300C deletion strains at different temperatures

    • Conduct complementation tests with temperature-sensitive alleles of known genes

    • Implement reciprocal hemizygosity tests under temperature stress conditions

    Understanding temperature sensitivity could place YBR300C in specific cellular pathways and provide insights into its evolutionary significance in environmental adaptation.

Methodological Considerations

  • What controls are essential when conducting reciprocal hemizygosity tests for YBR300C?

    For valid reciprocal hemizygosity testing of YBR300C:

    • Include wild-type diploid strains (e.g., BY4743) as baseline controls

    • Create and test multiple independent deletion strains to control for second-site mutations

    • Include marker-only controls to assess effects of selective markers

    • Use S288c derivatives like YJF173 (MATa, ho-, ura3-52) as additional controls

    • Randomize strain positions on plates, excluding border positions which should be filled with control strains

    • Take pictures in multiple orientations to control for lighting variation effects

    • Measure multiple colonies per strain (minimum of four) to account for colony-to-colony variation

    • Apply statistical analysis using linear models to distinguish significant differences

  • How should researchers interpret and validate contradictory findings about YBR300C?

    When confronted with contradictory data regarding YBR300C:

    • Critically evaluate experimental designs in published studies

    • Consider genetic background effects (S288c vs. other strain backgrounds)

    • Assess the possibility of second-site mutations in deletion strains

    • Implement complementation studies with wild-type YBR300C

    • Conduct Receiver Operating Characteristic (ROC) analysis to evaluate diagnostic performance of phenotypic assays

    • Design experiments that address specific issues of "experimental design and data analysis"

    • Cross-reference with genome-wide studies to contextualize findings

    • Consider epigenetic effects and growth conditions that might influence results

    This systematic approach helps resolve contradictions and builds a more coherent understanding of YBR300C function.

  • What experimental approaches can determine if YBR300C has regulatory effects on gene expression?

    To investigate potential regulatory roles of YBR300C:

    • Perform RNA-seq or microarray analysis comparing wild-type and YBR300C deletion strains

    • Conduct chromatin immunoprecipitation (ChIP) experiments with tagged YBR300C

    • Analyze promoter regions of differentially expressed genes for common motifs

    • Implement reporter gene assays to test direct regulatory effects

    • Use electrophoretic mobility shift assays (EMSA) to test DNA-binding capabilities

    • Create point mutations in potential functional domains to identify critical residues

    • Analyze effects under different growth conditions and stress responses

    • Apply approaches similar to those used in two-dimensional transcriptome analysis in chemostat cultures

    These methodologies can reveal whether YBR300C functions in transcriptional regulation, RNA processing, or other aspects of gene expression control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.