Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL002C (YCL002C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YCL002C

The Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL002C (YCL002C) is a protein encoded by the gene YCL002C in the yeast Saccharomyces cerevisiae. Despite its designation as uncharacterized, proteins like YCL002C are crucial for understanding the full functional repertoire of yeast, which is widely used in biotechnology and research. This article aims to provide an overview of what is known about YCL002C, its potential functions, and the broader context of its study.

Gene Information for YCL002C

  • Gene Name: YCL002C

  • Organism: Saccharomyces cerevisiae

  • Description: Putative uncharacterized protein

Potential Functions and Research Directions

While YCL002C is currently uncharacterized, research into similar proteins in S. cerevisiae suggests several potential areas of investigation:

  • Cellular Processes: Proteins in yeast often participate in essential cellular processes such as metabolism, cell cycle regulation, or stress response.

  • Protein-Protein Interactions: Identifying interacting partners could provide clues about YCL002C's function.

  • Expression Patterns: Studying the expression of YCL002C under different conditions could reveal its involvement in specific biological pathways.

Research Challenges and Opportunities

Studying uncharacterized proteins like YCL002C poses several challenges:

  • Lack of Functional Data: The absence of detailed functional studies makes it difficult to predict the protein's role.

  • Genetic and Biochemical Approaches: Techniques such as gene knockout, overexpression, and biochemical assays are necessary to elucidate the protein's function.

Despite these challenges, investigating YCL002C offers opportunities to expand our understanding of yeast biology and potentially uncover novel biological pathways.

Example Table: General Approach to Studying Uncharacterized Proteins

StepMethodologyObjective
1. Sequence AnalysisBioinformatics tools (e.g., BLAST, Pfam)Identify potential domains or homologs
2. Expression StudiesRT-PCR, Western BlotDetermine expression patterns under different conditions
3. Genetic ManipulationGene knockout or overexpressionAssess phenotypic changes
4. Biochemical AssaysProtein purification and interaction studiesIdentify interacting partners and enzymatic activities

References:

- Saccharomyces cerevisiae gene information: YCL002C.
- Saccharomyces cerevisiae as a model organism.

  • General literature on yeast genetics and molecular biology.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
The delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Important: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YCL002C; YCL2C; Putative uncharacterized protein YCL002C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YCL002C
Target Protein Sequence
MLVIVLQGLAGFLSIIAILCQKRYNKLHRSIYGLSYDLFLLDFVGNGLYLYCALHYCYSS LVREQLSQRFPLFYPLNDARSIPISSFLILKDFCVSCCCMMVLRQLYYYRSTKHIYQGIS ITSIIIISVFLVLGIFTYGCSISNLPLKNSGKFGVFYLEHINYLWVMANLLKCFKYVPQM SINWMGCSTVGLSSKFALISFLAESIDLLGRLVIPTNALFYEIPFNSTPFWVKLIQFVTL LVILCQVQYVYVGRKPRLPKGKL
Uniprot No.

Target Background

Database Links

KEGG: sce:YCL002C

STRING: 4932.YCL002C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YCL002C and where is it located in the S. cerevisiae genome?

YCL002C is a putative uncharacterized protein in the budding yeast Saccharomyces cerevisiae. The designation "YCL002C" follows the systematic naming convention for yeast genes, where "Y" indicates yeast, "C" represents chromosome III, "L" indicates the left arm of the chromosome, "002" denotes its position, and "C" indicates that it is transcribed from the complementary strand. This gene is part of the reference genome sequence derived from laboratory strain S288C . According to available data, the protein encoded by YCL002C consists of 263 amino acids in its full-length form .

What experimental evidence exists regarding YCL002C function?

Despite being included in the annotated S. cerevisiae genome, YCL002C remains functionally uncharacterized with limited direct experimental evidence. The Saccharomyces Genome Database (SGD) contains curated information about this gene, including any existing GO annotations for molecular function, biological process, and cellular component . Researchers studying YCL002C should first consult SGD for the most up-to-date annotations and phenotypic data from both classical genetics approaches and high-throughput studies. Any functional characterization would likely require comparative analysis with other more well-characterized proteins or domains, combined with experimental validation through techniques such as gene knockout/knockdown and phenotypic analysis.

What structural features characterize the YCL002C protein?

The YCL002C protein is a 263 amino acid protein that can be recombinantly produced with tags (such as His-tag) for purification and characterization purposes . Structural information is relatively limited, but researchers can utilize bioinformatic tools to predict secondary structure elements, potential domains, and post-translational modification sites. When working with recombinant forms, it's important to consider how tags might affect protein folding and function. Current sequence-derived properties like molecular weight and isoelectric point are available through the Saccharomyces Genome Database, along with experimentally-determined properties like median abundance when available .

What expression systems are most effective for recombinant YCL002C production?

Based on available information, E. coli has been successfully used as an expression system for producing recombinant full-length YCL002C protein with a His-tag . When designing expression strategies for YCL002C, researchers should consider:

  • Expression vector selection: Vectors with inducible promoters (e.g., IPTG-inducible T7 promoter) often provide better control over expression.

  • Codon optimization: Codon usage differs between yeast and E. coli; optimization may improve expression levels.

  • Fusion tags: While His-tags facilitate purification, other tags like GST or MBP may improve solubility.

  • Expression conditions: Temperature, induction time, and media composition should be optimized to maximize yield while maintaining protein folding.

For researchers requiring native post-translational modifications, yeast-based expression systems (including S. cerevisiae itself) might be preferable despite potentially lower yields.

How can researchers generate and validate YCL002C mutants for functional studies?

To generate YCL002C mutants for functional characterization, researchers can employ several approaches:

  • CRISPR/Cas9 gene editing: Design guide RNAs targeting YCL002C and introduce specific mutations through homology-directed repair.

  • Traditional homologous recombination: Replace YCL002C with a selection marker or modified version using PCR-generated cassettes with homology arms.

  • Plasmid-based complementation: Express wild-type or mutant versions of YCL002C in a deletion background to assess functional rescue.

Validation should include:

  • PCR verification of genomic modifications

  • Sequencing to confirm the intended mutations

  • Expression analysis via RT-PCR or Western blotting

  • Phenotypic characterization comparing mutant strains to wild-type and complete deletion strains

The SGD database contains information about existing curated mutant alleles for YCL002C that researchers can reference when designing their mutational studies .

What are optimal approaches for detecting YCL002C expression and localization in yeast cells?

For investigating YCL002C expression and localization, researchers can employ complementary techniques:

  • Transcriptional analysis:

    • RT-qPCR to quantify YCL002C mRNA levels under different conditions

    • RNA-seq for genome-wide expression context

    • Northern blotting for transcript size verification

  • Protein detection:

    • Generation of specific antibodies against YCL002C

    • Epitope tagging (GFP, FLAG, HA) for detection with commercial antibodies

    • Western blotting to assess protein levels and processing

  • Subcellular localization:

    • Fluorescence microscopy using GFP/YFP-tagged YCL002C

    • Immunofluorescence with specific antibodies

    • Subcellular fractionation followed by Western blotting

    • Colocalization with organelle markers

When tagging YCL002C, consider both N- and C-terminal fusions, as one orientation may disrupt localization signals or protein function.

How should synthetic recombinant populations be designed to study YCL002C variation?

For studying YCL002C variation in different genetic backgrounds, synthetic recombinant populations offer powerful approaches. Based on methodologies used for creating diverse yeast populations, researchers can employ two main strategies:

  • K-type crossing design: This involves mass mating of mixed populations where haploid strains with different genetic backgrounds are combined and allowed to mate randomly. While less labor-intensive, this approach may result in uneven founder representation .

  • S-type crossing design: This method involves more controlled pairwise crossings where haploid strains are paired with specific partners of the opposite mating type. This approach requires tetrad dissection to isolate meiotic products but produces more even founder haplotype representation and potentially higher genetic variation .

For studying YCL002C specifically, researchers should consider:

  • Including founder strains known to have interesting YCL002C variants

  • Monitoring YCL002C allele frequencies through multiple outcrossing cycles

  • Implementing selection protocols that might reveal YCL002C phenotypes

  • Sequencing populations at different timepoints (e.g., after 0, 6, and 12 cycles of outcrossing) to track YCL002C allele dynamics

What bioinformatic approaches are most effective for analyzing YCL002C sequence conservation and predicting function?

For computational analysis of YCL002C, a multi-layered bioinformatic approach is recommended:

  • Sequence homology analysis:

    • BLASTP searches against fungal genomes to identify orthologs and paralogs

    • Multiple sequence alignment to identify conserved residues

    • Phylogenetic analysis to understand evolutionary relationships

  • Structural prediction:

    • Secondary structure prediction (e.g., PSIPRED, JPred)

    • 3D structure modeling using AlphaFold or similar tools

    • Domain prediction using InterProScan, Pfam, SMART

  • Functional inference:

    • Gene Ontology term enrichment among similar proteins

    • Protein-protein interaction network analysis

    • Co-expression pattern analysis across conditions

  • Integrative approaches:

    • Machine learning methods combining multiple features

    • Structural alignments with functionally characterized proteins

    • Molecular dynamics simulations to identify potential binding sites

The Saccharomyces Genome Database provides tools for many of these analyses, including BLASTN/BLASTP against fungi and links to external resources .

How can researchers resolve contradictory findings about YCL002C function across different experimental systems?

When facing contradictory results regarding YCL002C function, consider implementing this systematic approach:

  • Strain background assessment:

    • Compare genetic backgrounds used in different studies

    • Check for potential suppressor mutations or genetic modifiers

    • Repeat key experiments in standardized strain backgrounds

  • Methodological variation analysis:

    • Compare experimental conditions (media, temperature, growth phase)

    • Evaluate differences in construct design (tags, promoters, terminators)

    • Assess sensitivity and specificity of detection methods

  • Integration of multiple evidence types:

    • Combine genetic, biochemical, and high-throughput data

    • Weigh evidence based on methodological rigor

    • Consider conditional or context-dependent functions

  • Collaborative validation:

    • Develop standardized reagents and protocols for cross-lab validation

    • Implement blinded experimental designs when possible

    • Share raw data and detailed protocols to identify sources of variation

For YCL002C specifically, contradictions might arise from its uncharacterized nature, making it essential to clearly define what constitutes evidence for a particular function.

What interacting partners have been identified for YCL002C?

Protein-protein interactions provide crucial insights into YCL002C function. While specific interacting partners are not detailed in the provided search results , researchers can identify potential interactions through:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged YCL002C in yeast

    • Purify protein complexes under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions using reciprocal tagging

  • Yeast two-hybrid screening:

    • Use YCL002C as bait against a yeast genomic or cDNA library

    • Implement stringent controls to minimize false positives

    • Validate interactions using orthogonal methods

  • Proximity labeling approaches:

    • Express YCL002C fused to BioID or APEX2

    • Identify proximal proteins via biotinylation and streptavidin pulldown

    • Distinguish between direct and indirect interactions

  • In silico prediction:

    • Use structural modeling to identify potential interaction interfaces

    • Leverage co-expression data to predict functional associations

    • Apply machine learning approaches trained on known interactions

When reporting interactions, researchers should clearly distinguish between physical interactions and functional associations, as well as between direct and indirect interactions.

What phenotypes are associated with YCL002C deletion or mutation?

Understanding phenotypic consequences of YCL002C disruption is fundamental to determining its function. According to the Saccharomyces Genome Database, phenotype annotations for YCL002C require standardized reporting including observable traits, qualifiers, mutant types, strain backgrounds, and references .

Researchers should investigate:

  • Growth phenotypes:

    • Growth rates in different media compositions

    • Stress response (temperature, osmotic, oxidative, pH)

    • Carbon source utilization patterns

    • Cell cycle progression and morphology

  • Molecular phenotypes:

    • Transcriptional changes in deletion strains (RNA-seq)

    • Proteomic alterations (mass spectrometry)

    • Metabolic profiles (metabolomics)

    • Genetic interaction profiles (synthetic lethality/sickness screens)

  • Conditional phenotypes:

    • Overexpression effects versus deletion

    • Temperature-sensitive alleles behavior

    • Chemical-genetic interactions with small molecules

    • Phenotypes in different genetic backgrounds

Phenotypic data should be classified as classical genetics or high-throughput approaches, with appropriate statistical analysis to determine significance.

How does YCL002C conservation compare across fungal species and what does this suggest about its function?

Evolutionary conservation analysis of YCL002C can provide valuable functional insights:

  • Phylogenetic distribution:

    • Identify YCL002C orthologs across fungal species using reciprocal BLAST

    • Determine presence/absence patterns across taxonomic groups

    • Assess conservation in pathogenic versus non-pathogenic fungi

    • Compare evolutionary rates with functionally characterized genes

  • Sequence conservation patterns:

    • Identify highly conserved motifs or residues

    • Detect signatures of positive or purifying selection

    • Compare conservation patterns with proteins of known function

    • Analyze conservation of predicted structural elements

  • Genomic context analysis:

    • Examine conservation of neighboring genes (synteny)

    • Identify co-evolving gene pairs or clusters

    • Compare regulatory elements across species

    • Assess conservation of intron-exon structures

  • Implications for function:

    • Highly conserved proteins often serve fundamental cellular roles

    • Proteins conserved only in specific lineages may have specialized functions

    • Rapidly evolving regions might indicate adaptive evolution

    • Conservation of specific domains suggests functional importance of those regions

The SGD database provides tools for comparative genomic analysis, including BLASTN/BLASTP searches against fungal genomes that can serve as starting points for conservation analysis .

What are the challenges in expressing and purifying full-length YCL002C protein?

The recombinant expression and purification of YCL002C present several technical challenges that researchers must address:

  • Expression optimization:

    • Codon optimization for the expression host system

    • Evaluation of different promoter strengths

    • Testing various induction conditions (temperature, inducer concentration, duration)

    • Comparison of different E. coli strains (BL21, Rosetta, Arctic Express)

  • Solubility considerations:

    • Assessment of protein solubility in different buffer systems

    • Co-expression with chaperones to improve folding

    • Use of solubility-enhancing fusion partners (MBP, SUMO, GST)

    • Testing detergents or mild solubilizing agents for membrane-associated proteins

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged YCL002C

    • Ion exchange chromatography based on isoelectric point

    • Size exclusion chromatography for final polishing

    • Tag removal considerations and efficiency

  • Protein validation:

    • SDS-PAGE and Western blotting to confirm identity

    • Mass spectrometry for accurate mass determination

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

Researchers have successfully expressed full-length YCL002C (263 amino acids) in E. coli with a His-tag , suggesting that bacterial expression is viable, though optimization may be required for specific experimental needs.

How can researchers design effective CRISPR/Cas9 strategies for YCL002C modification?

CRISPR/Cas9 genome editing offers powerful approaches for studying YCL002C function through precise genetic modifications:

  • Guide RNA design:

    • Select target sites with minimal off-target potential

    • Design sgRNAs with optimal GC content (40-60%)

    • Avoid regions with secondary structure that might impair Cas9 binding

    • Target conserved domains for functional disruption or regulatory regions for expression control

  • Repair template design:

    • For knock-ins or specific mutations, include 40-60 bp homology arms

    • For tagging, ensure in-frame fusion with appropriate linkers

    • Incorporate silent mutations in the PAM site to prevent re-cutting

    • Consider marker integration for selection (e.g., antibiotic resistance)

  • Delivery methods:

    • Traditional yeast transformation with lithium acetate

    • Electroporation for increased efficiency

    • Pre-assembled Cas9-sgRNA ribonucleoproteins for transient editing

    • Plasmid-based expression with appropriate promoters (e.g., SNR52 for sgRNA)

  • Screening and validation:

    • PCR-based screening strategies for identifying edited clones

    • RFLP analysis when edits create or destroy restriction sites

    • Sanger sequencing to confirm precise edits

    • Whole genome sequencing to check for off-target effects in critical experiments

When modifying YCL002C, researchers should consult existing mutant allele information from the SGD database to guide their editing strategies.

What high-throughput approaches can reveal YCL002C function in diverse genetic backgrounds?

Advanced high-throughput techniques can accelerate functional discovery for uncharacterized proteins like YCL002C:

  • Synthetic genetic array (SGA) analysis:

    • Cross YCL002C deletion with genome-wide deletion collection

    • Identify synthetic lethal or synthetic sick interactions

    • Map YCL002C into functional genetic networks

    • Compare genetic interaction profile with genes of known function

  • Barcode-based pooled screens:

    • Create barcoded YCL002C variant libraries

    • Subject pooled populations to selection conditions

    • Use next-generation sequencing to quantify variant frequencies

    • Identify variants with fitness advantages or disadvantages

  • Recombinant population approaches:

    • Study YCL002C in synthetic recombinant populations with diverse founders

    • Use both K-type (random mating) and S-type (controlled crossing) designs

    • Track allele frequencies through multiple rounds of outcrossing

    • Sequence populations at different timepoints to observe evolutionary dynamics

  • Transcriptomic and proteomic profiling:

    • Compare wild-type and YCL002C mutant expression profiles

    • Identify differentially expressed genes and proteins

    • Apply gene set enrichment analysis to identify affected pathways

    • Integrate multiple omics datasets for comprehensive functional insights

These approaches leverage the powerful genetics of S. cerevisiae and can reveal functions that might be missed by targeted studies, particularly for uncharacterized proteins like YCL002C.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.