Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)

Shipped with Ice Packs
In Stock

Description

Gene and Genomic Context

The YCL021W-A gene resides on chromosome III of S. cerevisiae S288C. Key genomic details include:

FeatureDescription
Genomic CoordinatesDerived from S. cerevisiae Reference Genome (strain S288C)
VectorpcDNA3.1-C-(K)DYK (used for ORF cloning with C-terminal DYKDDDDK tags)
Expression RegionFull-length (1–125 aa)
Functional AnnotationsNo Gene Ontology (GO) terms assigned (Biological Process, Molecular Function, Cellular Component)

The absence of GO annotations underscores the lack of functional characterization .

Protein-Protein Interactions

YCL021W-A has been implicated in interactions via genome-wide screens:

  • Interaction with HIS2: A Protein-Fragment Complementation Assay (PCA) identified a potential interaction between YCL021W-A and HIS2, a histidine biosynthesis enzyme . While the biological relevance remains unverified, this suggests a possible role in metabolic pathways.

Genome-Wide Mutation Studies

A genome-wide screen for genes affecting spontaneous mutation rates included YCL021W-A, though it showed no significant impact (fluctuation test value: 0.0) compared to controls like SIP3 (17.2) and HST4 (27.1) . This suggests it may not play a major role in DNA repair or replication fidelity under tested conditions.

Functional Gaps and Future Directions

Despite its availability, YCL021W-A remains poorly characterized. Critical gaps include:

  • Lack of Functional Data: No GO annotations or biochemical assays confirm its role in cellular processes.

  • Interaction Validation: The HIS2 interaction requires orthogonal validation (e.g., co-IP, co-localization).

  • Strain-Specific Studies: Most data derive from S. cerevisiae S288C; phenotypic analysis in other strains is needed.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YCL021W-A; Putative uncharacterized protein YCL021W-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YCL021W-A
Target Protein Sequence
MVLTDAEELRSPVITSDMSFFDLESNHSSDSVHLLCEKYTHKLPIESESQTTFRLAPTKQ RLYRQSTLYVPLSLKQRVFLFTERVKSIWAGLPRCKPNKYFKVAFALAVLTPLAIWIFYI DFRVH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YCL021W-A and what is currently known about its characteristics?

YCL021W-A is a putative uncharacterized protein in Saccharomyces cerevisiae that has been identified through genomic analysis. While its precise function remains to be fully elucidated, it is part of the yeast genome and has been included in various systematic studies. The protein is classified as "putative uncharacterized," indicating that bioinformatic analysis has predicted its existence, but experimental validation of its specific functions remains incomplete. Current research suggests that it may play a role in metabolic pathways, as deletion studies have shown alterations in amino acid profiles when this gene is removed .
The protein can be recombinantly expressed in various systems including E. coli, yeast, mammalian cells, and insect cells, making it accessible for experimental manipulation and characterization . YCL021W-A is one of many yeast proteins being investigated as part of the broader effort to understand the complete functional proteome of S. cerevisiae, which serves as an important model organism for eukaryotic biology.

How does YCL021W-A fit into the broader context of S. cerevisiae as a model organism?

S. cerevisiae serves as one of the most widely used eukaryotic model organisms in biological research. Approximately 30% of genes implicated in human disease have orthologs in the yeast proteome, making it a valuable system for studying conserved biological processes . YCL021W-A exists within this context as one of the thousands of genes in the yeast genome that contribute to its cellular functions.
When considering model organism selection, researchers analyze protein networks involved in specific biological processes to compare differences between S. cerevisiae and other organisms. This approach helps predict which processes might behave similarly across species . For YCL021W-A research, this comparative framework is essential for understanding whether findings in yeast can be extrapolated to other organisms, particularly for studies related to metabolism and potential disease associations.
The study of YCL021W-A contributes to our understanding of yeast biology, while potentially offering insights into conserved eukaryotic processes depending on the degree of conservation of this protein across species.

What expression systems are optimal for producing recombinant YCL021W-A protein?

Multiple expression systems can be utilized for the recombinant production of YCL021W-A, each with distinct advantages depending on your research objectives:

  • E. coli expression systems: Ideal for high-yield production, particularly when using strains such as BL21(DE3), JM115, or Rosetta-GAMI. This system is recommended for structural studies requiring substantial protein quantities .

  • Yeast expression systems: Using host strains like SMD1168, GS115, or X-33 provides a eukaryotic environment that may facilitate proper folding and post-translational modifications. This homologous expression approach is particularly valuable when studying YCL021W-A in its native context .

  • Mammalian expression systems: Cell lines including 293, 293T, NIH/3T3, COS-7, and CHO are appropriate when investigating potential interactions with mammalian proteins or when specific mammalian post-translational modifications are required .

  • Insect cell expression systems: Sf9, Sf21, or High Five cells offer a middle ground between prokaryotic yield and eukaryotic processing capabilities .
    For optimal results, consider using fusion tags to facilitate purification and enhance solubility. Common options include His, FLAG, MBP, GST, trxA, Nus, Biotin, or GFP tags, which can be positioned at either the N or C terminus depending on structural considerations . The selection of an expression system should align with specific experimental requirements, including protein yield, purity (available at >80%, >90%, or >95%), and downstream applications.

What methodological approaches can be used to study the function of YCL021W-A?

Several methodological approaches can be employed to elucidate the function of the uncharacterized YCL021W-A protein:

How does deletion of YCL021W-A affect metabolic profiles in S. cerevisiae?

Deletion of YCL021W-A results in measurable alterations in the metabolic profile of S. cerevisiae, particularly affecting amino acid homeostasis. Metabolic gene card analysis for this ORF reveals specific patterns of amino acid concentration changes when compared to wild-type strains . These changes provide a direct phenotypic readout for the gene deletion and offer insights into the gene's contribution to metabolic regulation.
The metabolic impact is assessed by measuring amino acid levels relative to the average of 4,678 deletion strains. Statistical significance of changes is determined through both univariate (Z-test) and multivariate (χ²-test) analyses, with p-values adjusted for multiple testing using the FDR method from Benjamini & Hochberg .
Notably, the specific pattern of amino acid alterations in YCL021W-A deletion strains allows researchers to cluster it with functionally similar genes. This clustering approach helps assign potential functions to uncharacterized genes based on metabolic signatures, operating under the principle that genes with similar functions cause similar metabolic perturbations .

What is known about YCL021W-A's potential role in genomic stability and recombination?

YCL021W-A may play a role in genomic stability, particularly in relation to recombination processes, as suggested by genome-wide screens for genes affecting spontaneous direct recombination. Spontaneous hyper-recombination in mitotic cells is a recognized hallmark of genomic instability, making the study of genes like YCL021W-A important for understanding mechanisms that maintain genome integrity .
Research methodologies for investigating YCL021W-A's role in recombination include:

  • Direct repeat recombination reporters: Systems such as the leu2DEcoRI-URA3-leu2DBstEII reporter allow for detection of recombination events through selection on specific media .

  • Synthetic Genetic Array (SGA) methodology: This approach enables systematic creation of strains carrying both the YCL021W-A deletion and recombination reporters, facilitating high-throughput analysis .

  • Fluctuation tests: Multiple independent cultures can be analyzed to quantify recombination rates and compare them to control strains .
    The potential involvement of YCL021W-A in recombination pathways may be particularly relevant considering that repeated sequences are abundant in mammalian genomes, suggesting implications for studies on recombination and genome integrity in human cells .

Are there orthologs of YCL021W-A in other organisms and what can we learn from them?

The identification of YCL021W-A orthologs across species provides valuable evolutionary context and potential functional insights. Comparative genomic approaches have been used to create clusters of orthologs (ScCOGs: S. cerevisiae Clusters of Orthologs) and homologues (ScCHGs: S. cerevisiae Clusters of Homologues) for S. cerevisiae proteins relative to the translated genomes of other organisms .
While specific information about YCL021W-A orthologs is limited in the provided sources, the methodology for identifying such relationships is well-established. Researchers can investigate conservation patterns to infer functional importance, as proteins conserved across evolutionary lineages often have fundamental biological roles.
The degree of conservation varies across different yeast pathways. For example, pathways such as RNA polymerase, lysosome function, endocytosis, oxidative phosphorylation, and ribosome assembly show high conservation between S. cerevisiae and other eukaryotes. In contrast, the yeast cell cycle (115 genes) appears more unique to S. cerevisiae and other Saccharomycetes, with only a small fraction of its proteins having orthologs in other eukaryotes .
Understanding where YCL021W-A falls on this spectrum of conservation would provide valuable insights into its biological significance and potential extrapolation of findings to other organisms.

How can ortholog identification inform YCL021W-A function prediction?

Ortholog identification serves as a powerful tool for predicting the function of uncharacterized proteins like YCL021W-A. Through comparative genomic analysis, researchers can identify conserved domains, structural features, and sequence patterns that suggest specific molecular functions.
The methodology for this approach involves:

  • Creating clusters of orthologs: Identifying YCL021W-A orthologs across species through sequence similarity searches and phylogenetic analysis .

  • Functional term association: Associating each cluster with functional terms corresponding to its biological role, cellular component, or molecular function .

  • Pathway comparison: Analyzing the similarity of pathways containing YCL021W-A between S. cerevisiae and other organisms to predict functional conservation .
    When a protein like YCL021W-A has well-characterized orthologs in other species, researchers can leverage this information to design targeted experiments that test predicted functions. This comparative approach is particularly valuable for uncharacterized proteins, providing a framework for hypothesis generation and experimental design.
    The extent to which findings about YCL021W-A in yeast can be extrapolated to other organisms depends largely on the degree of conservation and the specific pathway context in which the protein functions.

Are there any disease associations with YCL021W-A or its potential human orthologs?

YCL021W-A disease associations are documented through Disease Ontology (DO) annotations, which consist of three mandatory components: a gene product, a term from the Disease Ontology controlled vocabulary, and an evidence code. These annotations are manually curated by SGD (Saccharomyces Genome Database) curators based on published literature or curatorial statements .
While the specific disease associations for YCL021W-A are not explicitly detailed in the provided search results, the framework for such annotations exists through the SGD. These annotations reflect our best understanding of disease association for this gene product and are periodically reviewed for accuracy and completeness .
The translational relevance of YCL021W-A research is supported by the fact that approximately 30% of genes implicated in human disease have orthologs in the yeast proteome . This suggests that studying YCL021W-A could potentially provide insights relevant to human health, particularly if human orthologs are identified.
For researchers interested in disease associations, it's important to note that annotations can be derived from both small-scale studies and high-throughput experiments. High-throughput annotations are often based on disease ontology mappings assigned by study authors rather than direct curator review, which may influence their interpretation .

How can yeast YCL021W-A research be leveraged for translational applications?

Leveraging YCL021W-A research in S. cerevisiae for translational applications requires systematic approaches to connect yeast biology with human health:

What are the optimal conditions for expressing and purifying recombinant YCL021W-A?

The optimal conditions for expressing and purifying recombinant YCL021W-A depend on several factors including the expression system, fusion tag selection, and intended downstream applications:
Expression System Selection:

  • E. coli: Optimal for high yield with strains like BL21(DE3) for general expression or Rosetta-GAMI for improved folding of proteins with rare codons .

  • Native yeast expression: Using S. cerevisiae strains provides the most authentic cellular environment with appropriate post-translational modifications .

  • Other eukaryotic systems: Mammalian or insect cell lines offer advantages for more complex processing requirements .
    Fusion Tag Considerations:

  • Purification efficiency: His tags offer simple one-step purification but may have lower specificity; alternative tags like FLAG provide higher specificity .

  • Solubility enhancement: MBP, GST, or Nus tags can significantly improve solubility of recombinant proteins .

  • Tag position: N-terminal or C-terminal placement should be determined based on structural considerations and functional domains .
    Purification Protocol Optimization:

  • Protein renaturation: May be necessary if expression results in inclusion bodies .

  • Endotoxin removal: Critical for applications involving cell culture or in vivo studies .

  • Filtration sterilization and lyophilization: Important for long-term storage and stability .
    A systematic approach to optimization would include small-scale expression trials varying temperature, induction time, and media composition, followed by purification method development based on the selected fusion tag and desired final purity level (available at >80%, >90%, or >95%) .

What advanced analytical methods are most appropriate for studying YCL021W-A function?

Advanced analytical methods for studying YCL021W-A function should be selected based on specific research questions and can include:
Metabolic Analysis:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.