Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL065W (YCL065W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YCL065W; YCL65W; Putative uncharacterized protein YCL065W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YCL065W
Target Protein Sequence
MLKYVVTDIGKMCLYIWPYRVWSWRRLFIFRVLNVVSIAILFETPHRLALVPNVCLYTHM AIPLSTCLFCLCLCICIKYDITQTQANNQRNLSLLFSVFHLVFSTIALSIYCIYQILILV KH
Uniprot No.

Target Background

Database Links

STRING: 4932.YCL065W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the localization of YCL065W in Saccharomyces cerevisiae?

YCL065W is one of the many uncharacterized proteins in the yeast proteome that lacks definitive localization data. While prediction tools such as DeepLoc-1.0 may suggest potential cellular compartments, experimental verification is essential. To determine localization, researchers should employ GFP fusion techniques, particularly using rapidly degraded fluorescent proteins (GFPdeg) that are degraded in the cytoplasm but protected in organelles . This approach has successfully identified numerous uncharacterized proteins potentially localized to mitochondria (UPMs).

For reliable localization data, implement the following methodology:

  • Create a GFPdeg fusion construct with YCL065W

  • Transform into appropriate yeast strains

  • Induce expression under various growth conditions

  • Observe localization using fluorescence microscopy

  • Confirm with co-localization markers for specific organelles

  • Validate with biochemical fractionation techniques

While YCL065W lacks a canonical N-terminal mitochondrial localization signal (as is common for many UPMs), it may still localize to specific organelles through non-canonical targeting sequences or protein-protein interactions .

How can I determine if YCL065W is expressed under standard laboratory conditions?

Since many uncharacterized proteins are expressed only under specific conditions, a systematic approach to expression analysis is crucial. Design experiments with the following variables:

Independent VariableLevelsMeasurement Method
Growth phaseLogarithmic, post-diauxic shift, stationaryRT-qPCR/Western blot
Carbon sourceGlucose, glycerol, ethanolRT-qPCR/Western blot
Stress conditionsOxidative, temperature, osmoticRT-qPCR/Western blot
Nutrient limitationNitrogen, phosphate, amino acidsRT-qPCR/Western blot

Post-diauxic shift conditions are particularly important to test, as some uncharacterized mitochondrial proteins show upregulated expression during this phase when respiratory metabolism dominates . This makes biological sense as mitochondrial development increases during this transition.

For each condition, measure both transcript levels (RT-qPCR) and protein abundance (Western blot with epitope-tagged versions). Genome-wide transcriptome data from existing datasets can provide preliminary insights before conducting targeted experiments .

What experimental controls should I include when studying YCL065W?

Robust experimental design requires appropriate controls to ensure reliable interpretation of results . For YCL065W studies, include:

  • Positive controls: Well-characterized proteins with similar predicted properties (size, charge, localization)

  • Negative controls: Empty vector constructs and unrelated proteins

  • Expression controls: Constitutively expressed housekeeping genes for normalization

  • Technical controls: Multiple biological and technical replicates to assess reproducibility

For localization studies, include controls for each cellular compartment. For functional assays, include both loss-of-function (knockout) and gain-of-function (overexpression) strains to detect subtle phenotypes. Document qualitative observations throughout the experimental procedure as these may provide unexpected insights into function .

How can CRISPR-Cas9 be utilized to study YCL065W function?

CRISPR-Cas9 technology offers powerful approaches to study uncharacterized proteins like YCL065W . Implementation strategies include:

  • Precise gene knockout: Generate clean deletions without marker genes

  • Endogenous tagging: Add epitope or fluorescent tags at the C- or N-terminus

  • Point mutations: Introduce specific amino acid changes to probe function

  • Promoter engineering: Replace native promoter with inducible/repressible alternatives

  • Contextual genomic changes: Relocate YCL065W to different chromosomal locations

When designing CRISPR-Cas9 experiments, carefully select guide RNAs to minimize off-target effects. For YCL065W, design at least three guide RNAs targeting different regions of the gene and validate editing efficiency.

The experimental approach should include:

  • Transforming CRISPR-Cas9 components with repair templates

  • Screening for successful editing events

  • Confirming modifications by sequencing

  • Phenotypic characterization across multiple conditions

  • Comparative analysis with wild-type controls

This approach is particularly valuable for studying proteins of unknown function as it allows precise manipulation without introducing extraneous genetic elements that might confound phenotypic analysis .

What approaches can identify potential interaction partners of YCL065W?

Understanding protein-protein interactions provides crucial insights into function. For YCL065W, employ multiple complementary techniques:

TechniqueAdvantagesLimitationsData Output
Affinity purification-mass spectrometry (AP-MS)Identifies stable complexesMay miss transient interactionsProtein identities and relative abundances
Proximity labeling (BioID/TurboID)Captures neighborhood proteinsPotential false positivesSpatial interactome map
Yeast two-hybrid (Y2H)Detects direct binary interactionsHigh false positive/negative ratesBinary interaction network
Co-immunoprecipitationValidates specific interactionsRequires good antibodiesConfirmation of direct interactions
Genetic interaction screeningFunctional relationshipsIndirect associationsGenetic interaction scores

For AP-MS studies, create both N- and C-terminally tagged versions of YCL065W to avoid interference with localization signals. Perform experiments under multiple growth conditions, particularly focusing on post-diauxic shift when mitochondrial functions are upregulated .

Cross-reference interaction data with:

  • Known protein complexes in databases

  • Co-expression patterns across conditions

  • Evolutionary conservation profiles

  • Localization data from imaging studies

Analysis of these datasets can reveal functional modules and suggest testable hypotheses about YCL065W function.

How can I determine if YCL065W is functionally redundant with other uncharacterized proteins?

Functional redundancy often explains the lack of phenotypes for uncharacterized genes . To investigate this possibility:

Many uncharacterized yeast proteins cluster into families with 2-5 members, often located near telomeres, tRNAs, or transposon-like sequences . If YCL065W belongs to such a cluster, simultaneously targeting multiple family members may reveal phenotypes not observed in single deletions.

What growth conditions should I test to identify phenotypes for YCL065W deletion strains?

Since many uncharacterized proteins function under specific conditions not routinely tested in laboratories , design a systematic phenotypic screen:

Condition CategorySpecific ConditionsMeasurement Parameters
Carbon metabolismGlucose, galactose, glycerol, ethanol, acetateGrowth rate, lag phase, maximum OD
Temperature16°C, 25°C, 30°C, 37°C, 39°CGrowth kinetics, morphology
Stress responseOxidative (H₂O₂), osmotic (NaCl, sorbitol), pH, metal ionsSurvival rate, stress response genes
Cell cycleSynchronization, checkpoint activationCell cycle progression, checkpoint integrity
Nutrient limitationNitrogen, phosphate, amino acids, vitaminsGrowth, cellular composition
Mitochondrial functionRespiratory inhibitors, mtDNA depletionOxygen consumption, membrane potential

If YCL065W is among the evolutionarily young "emerging genes" that exist only in S. cerevisiae , test conditions specific to the ecological niche of this species, such as fermentation-related stresses or nutrient fluctuations typical in natural environments.

Monitor growth using high-resolution methods (e.g., plate readers or microfluidics) capable of detecting subtle phenotypic differences that might be missed by conventional techniques. Perform competition assays with wildtype strains to reveal fitness effects too subtle for direct observation.

How should I analyze transcriptomic changes in YCL065W deletion or overexpression strains?

Transcriptome analysis can reveal functional pathways affected by YCL065W manipulation:

  • Experimental design considerations:

    • Include multiple biological replicates (minimum 3)

    • Control for growth phase effects by harvesting at standardized cell densities

    • Include both deletion and overexpression strains

    • Test multiple environmental conditions, particularly those that alter mitochondrial development

  • Analysis workflow:

    • Normalize data using appropriate methods (e.g., DESeq2, edgeR)

    • Identify significantly altered genes using adjusted p-value cutoffs

    • Perform gene ontology (GO) enrichment analysis

    • Map changes to known regulatory networks

    • Compare to existing transcriptome datasets for similar conditions

  • Validation strategies:

    • Confirm key expression changes with RT-qPCR

    • Test protein-level changes for selected candidates

    • Follow up on biological pathways identified with targeted assays

Pay special attention to genes that change expression during post-diauxic shift, as some uncharacterized mitochondrial proteins show coordinated expression during this transition . If YCL065W affects mitochondrial function, expect changes in nuclear genes involved in mitochondrial biogenesis, metabolism, or stress response.

What are the most common sources of experimental error when characterizing uncharacterized proteins, and how can they be mitigated?

Identifying and addressing potential sources of error is critical for reliable characterization :

  • Tagging artifacts:

    • Error: Epitope or fluorescent tags disrupting protein function or localization

    • Mitigation: Use small tags, test both N- and C-terminal fusions, validate with alternative methods

  • Condition-dependent functionality:

    • Error: Missing phenotypes due to testing limited conditions

    • Mitigation: Systematic phenotyping across diverse environments, stress conditions, and genetic backgrounds

  • Redundancy effects:

    • Error: Absence of phenotypes due to functional backup systems

    • Mitigation: Create multiple knockout combinations, temporarily inhibit potential redundant pathways

  • Expression timing issues:

    • Error: Studying proteins at inappropriate time points

    • Mitigation: Time-course experiments, inducible expression systems, cell-cycle synchronization

  • Technical variability:

    • Error: Confounding experimental noise with biological effects

    • Mitigation: Increase replication, standardize protocols, use spike-in controls

For YCL065W specifically, if it belongs to the class of evolutionarily young genes with no N-terminal mitochondrial localization signal , particular attention should be paid to non-canonical targeting mechanisms and condition-specific expression patterns.

How does the evolutionary age of YCL065W inform experimental approaches to characterize its function?

The evolutionary context of uncharacterized proteins provides important clues for functional studies:

Many uncharacterized mitochondrial proteins in S. cerevisiae are evolutionarily young "emerging genes" that exist only in this species . This evolutionary pattern suggests:

  • Species-specific functions: YCL065W may perform functions specific to S. cerevisiae's ecological niche rather than core cellular processes

  • Non-canonical mechanisms: These proteins often lack classical targeting signals and may use alternative localization mechanisms

  • Condition-specific roles: They frequently function under specific conditions relevant to yeast's natural environment

Experimental design implications include:

  • Comparative genomics to determine if YCL065W has homologs in related species

  • Testing conditions specific to S. cerevisiae's natural habitat

  • Investigating non-canonical targeting and interaction mechanisms

  • Examining expression patterns during stress responses or life cycle transitions

The evolutionary age also informs expectations about phenotypic effects - younger genes often show more subtle phenotypes and greater condition-dependency than conserved genes .

What techniques can determine if YCL065W is involved in chromosome maintenance or genomic stability?

Given the potential role of some uncharacterized proteins in chromosome biology (as suggested by search result ), specific assays can evaluate YCL065W's involvement in these processes:

  • Chromosome loss assays: Monitor the rate of loss of a non-essential marked chromosome in wild-type versus YCL065W deletion strains

  • DNA damage sensitivity: Test survival after exposure to genotoxic agents:

    • UV irradiation

    • Methyl methanesulfonate (MMS)

    • Hydroxyurea (HU)

    • Camptothecin (CPT)

  • Recombination rate measurement: Quantify homologous recombination using reporter constructs

  • Sister chromatid cohesion analysis: Assess premature separation of sister chromatids using fluorescently tagged chromosomal loci

  • Mitotic checkpoint integrity: Evaluate cell cycle arrest in response to spindle poisons

  • Replication dynamics: Measure origin firing and fork progression using DNA combing or sequencing-based approaches

If YCL065W localizes near telomeres or other chromosome structural elements, these assays may reveal subtle phenotypes missed in standard growth assays. Additionally, combining YCL065W deletion with mutations in known chromosome maintenance genes may uncover synthetic interactions indicating parallel pathways .

How can I address the challenge of functional characterization when YCL065W shows no obvious phenotype under standard conditions?

The absence of obvious phenotypes is common for uncharacterized yeast genes and requires specialized approaches :

  • High-sensitivity fitness assays:

    • Competitive growth with barcode sequencing

    • Continuous culture under selective pressure

    • Single-cell growth tracking in microfluidic devices

  • Combinatorial genetic perturbations:

    • Synthetic genetic array analysis in different conditions

    • Triple or quadruple mutant construction with related genes

    • Chemical-genetic interactions using sublethal drug concentrations

  • Molecule-level characterization:

    • Structural analysis (if protein can be purified)

    • In vitro biochemical activity screens

    • Metabolomic analysis to detect subtle metabolic changes

  • Systems-level approaches:

    • Integration of multiple omics datasets (transcriptome, proteome, metabolome)

    • Network analysis to predict function from connectivity patterns

    • Computational prediction followed by targeted validation

  • Evolutionary approaches:

    • Experimental evolution under selective pressure

    • Comparative analysis across yeast species

    • Analysis of natural variation in different strains

Remember that approximately 80% of yeast gene deletions show no obvious phenotype under standard laboratory conditions . This doesn't indicate lack of function but rather suggests condition-specific roles or genetic buffering through redundant systems.

What are the implications of YCL065W characterization for understanding mitochondrial biology in eukaryotes?

The characterization of uncharacterized mitochondrial proteins has significant implications:

  • Complete mitochondrial proteome: Despite decades of research, we still lack a complete functional understanding of the mitochondrial proteome. YCL065W may represent one of the missing pieces in this puzzle.

  • Non-canonical import mechanisms: If YCL065W lacks traditional mitochondrial targeting signals but localizes to mitochondria , its characterization could reveal alternative import pathways.

  • Condition-specific mitochondrial functions: Many uncharacterized proteins show expression changes during respiratory metabolism activation . YCL065W may participate in adaptation to changing metabolic demands.

  • Evolutionary innovations: As potentially an evolutionarily young gene , YCL065W might represent a species-specific adaptation in mitochondrial function.

  • Disease relevance: Understanding all mitochondrial proteins is crucial for comprehending mitochondrial diseases. Even yeast-specific proteins can reveal principles applicable to human mitochondrial biology.

Future research should integrate YCL065W characterization with comprehensive mitochondrial interaction networks and functional analyses across diverse conditions to place it in the broader context of organelle biology.

How can high-throughput methodologies be optimized for studying proteins like YCL065W?

High-throughput approaches require careful optimization for uncharacterized proteins:

  • Customized screening conditions:

    • Design condition arrays specifically targeting mitochondrial functions

    • Include respiratory, fermentative, and transitional metabolic states

    • Test fluctuating environments that mimic natural conditions

  • Multiparametric phenotyping:

    • Move beyond growth-only assays to include morphological, metabolic, and stress-response parameters

    • Implement high-content imaging to capture subtle phenotypic changes

    • Develop reporter systems for specific cellular processes

  • Integrated data analysis:

    • Combine data from multiple high-throughput methods

    • Apply machine learning to identify patterns in complex datasets

    • Develop visualization tools for multidimensional phenotypic data

  • Advanced genetic manipulation strategies:

    • CRISPR-based saturation mutagenesis to probe protein domains

    • Inducible degradation systems for temporal control

    • Synthetic genetic interaction mapping in diverse conditions

  • Novel protein interaction methods:

    • Adaptation of proximity labeling for specific subcellular compartments

    • Split-reporter systems optimized for mitochondrial proteins

    • In vivo crosslinking approaches for capturing transient interactions

These optimized approaches can overcome the challenges of studying proteins that function under specific conditions or have subtle phenotypes when disrupted .

What are the recommended next steps for researchers beginning work on YCL065W?

For researchers initiating studies on YCL065W, a systematic approach is recommended:

  • Initial characterization:

    • Confirm expression using epitope tagging and western blotting

    • Determine subcellular localization using fluorescent protein fusions

    • Create clean deletion strains and test growth across diverse conditions

    • Examine expression patterns during different growth phases and stresses

  • Preliminary functional analysis:

    • Conduct phenotypic profiling under respiratory and fermentative conditions

    • Test mitochondrial function parameters in deletion strains

    • Perform basic transcriptome analysis to identify affected pathways

    • Screen for genetic interactions with known mitochondrial genes

  • Relationship to other uncharacterized proteins:

    • Identify potential paralogs or functionally related uncharacterized proteins

    • Create double or triple mutants to test redundancy

    • Compare expression patterns and phenotypic profiles

  • Advanced characterization based on initial findings:

    • If mitochondrial localization is confirmed, focus on specific mitochondrial processes

    • If genetic interactions are found, explore the related biological pathway

    • If condition-specific expression is observed, investigate the regulatory mechanisms

  • Integration with existing knowledge:

    • Connect findings to known mitochondrial functions and stress responses

    • Place YCL065W in the context of yeast evolutionary biology

    • Consider potential biotechnological applications based on function

Throughout this process, remain open to unexpected findings and be prepared to pivot research directions based on emerging data . The characterization of uncharacterized proteins often leads to discovery of novel cellular mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.