Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCR081C-A (YCR081C-A)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Functional Context

  • Sequence Homology: Limited homology to annotated proteins in S. cerevisiae suggests a novel function or specialization in niche cellular processes .

  • Pathway Involvement: Preliminary data from Creative BioMart indicate potential links to undefined pathways, though specific connections require validation .

  • Interactions: No confirmed protein interactions are documented, but studies using His-tagged variants could enable co-IP or pull-down assays to map binding partners .

Research Applications

While functional data are scarce, YCR081C-A’s availability as a recombinant protein enables targeted studies:

ApplicationMethodologyPotential Insights
Structural AnalysisX-ray crystallography/NMR3D conformation, active site identification
Functional ScreensYeast knockout complementation, TAP-tagged overexpressionRole in stress response, metabolism, or signaling
Immunological StudiesAntibody-based detection (e.g., ORB849959 from Biorbyt) Tissue/cellular localization in S. cerevisiae

Challenges and Future Directions

  • Functional Elucidation: The lack of annotated homologs necessitates high-throughput screens (e.g., CRISPR knockout libraries) to identify phenotypes .

  • Reagent Availability: Limited commercial antibodies (e.g., Biorbyt’s unconjugated ORB849959) hinder immunological studies.

  • Industrial Relevance: S. cerevisiae’s prominence in biofuel/ethanol production suggests YCR081C-A could modulate metabolic pathways, though direct evidence is absent.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YCR081C-A; Putative uncharacterized protein YCR081C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-78
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YCR081C-A
Target Protein Sequence
MWIFPLKPSIKKTQVYTGIVKRSRIITACSHVICVLGIIVGDEVVRLHGKCADIFMIFLV INEPFLFVFVRYFNYADS
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.