Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YDL009C (YDL009C) is a small, cytosol-localized protein encoded by the YDL009C gene in S. cerevisiae. Initially identified through ribosome profiling as a translated mRNA , it has no established biochemical function or conserved domains, earning its classification as an uncharacterized protein. Despite its lack of functional annotation, it has been studied in genetic networks and is available as a recombinant product for experimental research .
The protein’s sequence begins with MKALSVLCFHNPFKRCLGQKSFFVGDSFFIPTPKRLVLGKLRLSNYTAFHDLIIHDLFIY IFILNFFFFPFCNNFNYWKVFHVAQPRIYHHSRLVMILKVSLECAVS . Recombinant versions are typically expressed in E. coli or yeast systems, often with N-terminal tags for purification .
YDL009C interacts with proteins in genetic networks, though its role remains unclear. Key associations include:
These connections suggest potential roles in stress adaptation or membrane-associated processes, though direct evidence is lacking .
ORF Overlap: Partially overlaps the verified ORF YDL010W, complicating functional studies .
Ribosome Profiling: Confirmed translation of its mRNA, validating its expression .
Recombinant YDL009C is marketed for research, often as a lyophilized or glycerol-stabilized product :
| Product Feature | Specification |
|---|---|
| Host System | E. coli, yeast, or baculovirus systems |
| Purity | ≥85% (SDS-PAGE validated) |
| Endotoxin Level | Low-endotoxin options available |
| Storage | -20°C (stable for extended storage) |
Localization Studies: Used in GFP/mCherry fusion experiments to confirm cytosolic localization .
Interaction Mapping: Serves as bait in co-IP or yeast two-hybrid assays to study genetic networks .
YDL009C remains poorly characterized due to:
Lack of Functional Domains: No homology to known catalytic or structural motifs .
Redundancy: Overlaps with YDL010W, complicating phenotypic analysis .
Limited Experimental Data: Most insights derive from bioinformatics and localization studies .
Future research should prioritize:
CRISPR-Based Knockouts: To test for subtle phenotypes in stress conditions.
Proteomic Profiling: To identify interaction partners or post-translational modifications.
| Gene | Length (aa) | Localization | Putative Function | Essentiality |
|---|---|---|---|---|
| YDL009C | 107 | Cytosol | Unknown | Non-essential |
| YDL012C | 107 | Plasma membrane | Stress response (CYSTM module) | Non-essential |
| YDR210W | 111 | Plasma membrane | Stress response (CYSTM module) | Non-essential |
YDL009C’s cytosolic localization distinguishes it from paralogs like YDL012C and YDR210W, which are tail-anchored membrane proteins linked to stress tolerance .
KEGG: sce:YDL009C
STRING: 4932.YDL009C
YDL009C is a putative uncharacterized protein in Saccharomyces cerevisiae that appears to be associated with DNA recombination and repair processes. While its precise function remains to be fully elucidated, research indicates it may play a role in genomic stability. The protein has been studied in genome-wide screens for genes affecting spontaneous direct recombination, suggesting its involvement in DNA metabolism . The association with MSH6, a component of the mismatch repair machinery, suggests potential roles in DNA repair pathways .
Multiple molecular biology techniques can be employed to study YDL009C expression:
Real-time quantitative PCR (RT-qPCR) using specific probe assays designed for gene expression analysis, such as those available commercially from Bio-Rad
Yeast deletion collection studies using synthetic genetic array (SGA) methodology to introduce recombination reporters into strains lacking YDL009C
Fluctuation tests to measure recombination events in strains with and without YDL009C, performed according to the Luria-Delbrück method
Colony measurement systems using image analysis software such as ImageJ and ScreenMill for quantitative assessment of phenotypes
For gene expression studies specifically, researchers typically use FAM-labeled fluorescent probes in conjunction with unlabeled PCR primers to detect and quantify YDL009C transcript levels .
YDL009C deletion strains have been studied in genome-wide screens, with the primary observed phenotype being altered rates of spontaneous direct recombination . These deletion strains can be constructed using standard yeast knockout methodologies and assessed through replica-plating on selective media (such as SD-leu) to detect recombination events. The experimental approach typically involves:
Constructing deletion strains with genotype MATa ydl009cΔ::kanMX carrying a leu2DEcoRI-URA3-leu2DBstEII recombination reporter
Streaking these strains on SD-ura media to confirm presence of the reporter
Replica-plating to SD-leu to visualize recombination events as papillae
Conducting fluctuation tests to quantify recombination rates
The YDL009C deletion strain shows quantifiable differences in recombination rates compared to wild-type strains, with measured rates of approximately 2.34E-05 .
Research data indicates that YDL009C is associated with DNA recombination processes. In genome-wide screens, YDL009C deletion has been shown to affect recombination rates, with measured rates of approximately 2.34E-05 (p-value: 1.02E-05) . This suggests the protein may normally function in pathways that regulate or constrain spontaneous recombination. To investigate this relationship, researchers typically:
Employ the leu2DEcoRI-URA3-leu2DBstEII marker system to measure direct-repeat recombination
Conduct fluctuation tests measuring recombination frequencies in wild-type versus deletion strains
Analyze colony growth on selective media to identify recombination events
Compare recombination rates with those of known recombination regulatory genes
The connection to MSH6 further suggests potential roles in pathways that maintain genomic stability through regulation of recombination processes .
Several genetic tools and resources are available for studying YDL009C:
YDL009C deletion strains from yeast knockout collections (such as EUROSCARF or the systematic yeast deletion collection)
Real-time PCR probe assays specifically designed for YDL009C gene expression analysis
PCR primers designed to amplify YDL009C for cloning or expression studies
Recombination reporter systems (e.g., leu2DEcoRI-URA3-leu2DBstEII) that can be introduced into YDL009C mutant backgrounds
SGA methodology for introducing reporters or creating double mutants with YDL009C
These tools allow researchers to conduct comprehensive genetic analyses of YDL009C function, expression, and interactions with other genes and pathways.
The search results indicate an association between YDL009C and MSH6 , suggesting a potential functional relationship in DNA repair pathways. MSH6 is a well-characterized component of the MutSα complex involved in recognizing and repairing DNA mismatches. To thoroughly investigate this relationship, researchers would typically:
Perform co-immunoprecipitation experiments to test for physical interactions between YDL009C and MSH6
Conduct epistasis analysis by creating double deletion mutants (ydl009cΔ msh6Δ) to determine if they function in the same or parallel pathways
Use fluctuation tests to compare recombination rates between single and double mutants
Employ fluorescence microscopy with tagged proteins to examine co-localization, especially following DNA damage
The data from recombination studies showing YDL009C's recombination rate of 2.34E-05 provides a quantitative foundation for these investigative approaches.
Based on the search results, YDL009C deletion affects recombination rates in Saccharomyces cerevisiae. Fluctuation tests reveal a recombination rate of 2.34E-05 with a p-value of 1.02E-05 . To methodically study this effect, researchers employ the following approaches:
Utilize the Luria-Delbrück fluctuation test methodology with direct-repeat recombination reporters
Culture independent colonies to saturation in YPD liquid medium
Plate appropriate dilutions on fully supplemented SD plates and on SD-leu plates to detect recombination events
Calculate recombination rates using statistical methods such as the method of the median or maximum likelihood
Compare these rates with wild-type strains and other known recombination mutants
This quantitative data is critical for positioning YDL009C within the network of genes affecting genomic stability in yeast.
To identify and characterize protein-protein interactions involving YDL009C, researchers should employ multiple complementary approaches:
Yeast two-hybrid screening using YDL009C as bait to identify potential interacting partners
Affinity purification coupled with mass spectrometry (AP-MS) using tagged YDL009C to isolate protein complexes
Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo
Protein co-immunoprecipitation followed by Western blotting to confirm specific interactions
In vitro binding assays using purified recombinant proteins to establish direct interactions
The suggested association with MSH6 provides a specific candidate for targeted interaction studies. Results from these experiments should be integrated with functional data from genetic studies to establish the biological relevance of identified interactions.
The search results describe several genome-wide approaches used to study YDL009C . To optimize these for more focused functional studies, researchers should consider:
Employing arrayed yeast deletion collections in 1536 format, with each strain in quadruplicate as described in the literature
Introducing specific reporters through SGA methodology to measure phenotypes of interest beyond recombination, such as DNA damage sensitivity
Utilizing automated pinning systems for replica plating onto selective media containing various stressors or DNA-damaging agents
Implementing computational image analysis using software like ImageJ and ScreenMill for quantitative assessment of colony growth under various conditions
Performing genetic interaction mapping by creating double mutants of YDL009C with other genes of interest
These approaches should be coupled with rigorous statistical analysis to identify significant phenotypic effects and genetic interactions.
To investigate potential roles of YDL009C in stress response pathways, researchers should design experiments examining expression and functionality under various stress conditions:
Perform RT-qPCR using YDL009C-specific probe assays under different stress conditions (oxidative stress, DNA damage, heat shock, nutrient limitation)
Create YDL009C promoter-reporter fusions to monitor transcriptional regulation under stress
Test sensitivity of YDL009C deletion strains to various stressors using spot dilution assays
Compare the transcriptional profile of wild-type and YDL009C deletion strains under stress using RNA-seq
Examine localization of tagged YDL009C protein under normal and stress conditions
These approaches would help determine whether YDL009C functions specifically in DNA metabolism or plays broader roles in cellular stress responses.
To optimize high-throughput screening for YDL009C studies, researchers should:
Design custom synthetic genetic array (SGA) screens focusing on DNA repair, recombination, or specific cellular stress pathways
Employ the colony array method described in the literature, where the yeast deletion collection containing recombination reporters is arrayed in 1536 format
Pin strains onto multiple condition plates to test various phenotypes simultaneously
Use automated imaging systems to capture colony growth at multiple time points
Apply sophisticated image analysis using software packages like ImageJ and ScreenMill Colony Measurement Engine
Incorporate rigorous statistical methods to account for plate-to-plate variation and identify significant hits
These optimizations would enable more comprehensive and sensitive detection of YDL009C-related phenotypes across thousands of genetic backgrounds or conditions.
When facing contradictory data about YDL009C function, researchers should:
Perform independent validation using multiple methodological approaches
Test YDL009C function in different strain backgrounds to account for genetic modifiers
Use complementation studies with wild-type YDL009C to confirm phenotypes are specifically due to its absence
Create point mutations in functional domains rather than complete gene deletions to distinguish between different aspects of protein function
Employ conditional expression systems to study dosage effects and timing requirements
Compare results from different screening approaches (e.g., patch screening versus pinning) as mentioned in the literature, where some recombination genes identified in patch screens were not detected in pinning screens
This multi-faceted approach helps reconcile apparently contradictory results and builds a more complete understanding of YDL009C function.