Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDL009C (YDL009C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YDL009C (YDL009C)

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YDL009C (YDL009C) is a small, cytosol-localized protein encoded by the YDL009C gene in S. cerevisiae. Initially identified through ribosome profiling as a translated mRNA , it has no established biochemical function or conserved domains, earning its classification as an uncharacterized protein. Despite its lack of functional annotation, it has been studied in genetic networks and is available as a recombinant product for experimental research .

Gene and Protein Overview

ParameterValue
Gene SymbolYDL009C
Entrez Gene ID851553
OrganismSaccharomyces cerevisiae S288C (strain)
Protein Length107 amino acids (aa)
Molecular Weight~12,725 Da (estimated from recombinant production)
Cellular LocalizationCytosol (confirmed via SWAT-GFP and mCherry fusion experiments)
EssentialityNon-essential (deletion viable)

The protein’s sequence begins with MKALSVLCFHNPFKRCLGQKSFFVGDSFFIPTPKRLVLGKLRLSNYTAFHDLIIHDLFIY IFILNFFFFPFCNNFNYWKVFHVAQPRIYHHSRLVMILKVSLECAVS . Recombinant versions are typically expressed in E. coli or yeast systems, often with N-terminal tags for purification .

Predicted Functional Partners

YDL009C interacts with proteins in genetic networks, though its role remains unclear. Key associations include:

Partner GeneScoreDescription
YDL012C0.698Cysteine-rich transmembrane protein involved in stress response
YDR210W0.770Tail-anchored membrane protein with conserved CYSTM module
YDL057W0.736Putative protein of unknown function

These connections suggest potential roles in stress adaptation or membrane-associated processes, though direct evidence is lacking .

Overlaps and Genetic Context

  • ORF Overlap: Partially overlaps the verified ORF YDL010W, complicating functional studies .

  • Ribosome Profiling: Confirmed translation of its mRNA, validating its expression .

Recombinant Protein Production

Recombinant YDL009C is marketed for research, often as a lyophilized or glycerol-stabilized product :

Product FeatureSpecification
Host SystemE. coli, yeast, or baculovirus systems
Purity≥85% (SDS-PAGE validated)
Endotoxin LevelLow-endotoxin options available
Storage-20°C (stable for extended storage)

Experimental Utility

  • Localization Studies: Used in GFP/mCherry fusion experiments to confirm cytosolic localization .

  • Interaction Mapping: Serves as bait in co-IP or yeast two-hybrid assays to study genetic networks .

Challenges and Future Directions

YDL009C remains poorly characterized due to:

  1. Lack of Functional Domains: No homology to known catalytic or structural motifs .

  2. Redundancy: Overlaps with YDL010W, complicating phenotypic analysis .

  3. Limited Experimental Data: Most insights derive from bioinformatics and localization studies .

Future research should prioritize:

  • CRISPR-Based Knockouts: To test for subtle phenotypes in stress conditions.

  • Proteomic Profiling: To identify interaction partners or post-translational modifications.

Comparative Analysis with Paralogs

GeneLength (aa)LocalizationPutative FunctionEssentiality
YDL009C107CytosolUnknownNon-essential
YDL012C107Plasma membraneStress response (CYSTM module)Non-essential
YDR210W111Plasma membraneStress response (CYSTM module)Non-essential

YDL009C’s cytosolic localization distinguishes it from paralogs like YDL012C and YDR210W, which are tail-anchored membrane proteins linked to stress tolerance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YDL009C; Uncharacterized protein YDL009C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDL009C
Target Protein Sequence
MKALSVLCFHNPFKRCLGQKSFFVGDSFFIPTPKRLVLGKLRLSNYTAFHDLIIHDLFIY IFILNFFFFPFCNNFNYWKVFHVAQPRIYHHSRLVMILKVSLECAVS
Uniprot No.

Target Background

Database Links

KEGG: sce:YDL009C

STRING: 4932.YDL009C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is YDL009C and what is known about its function in Saccharomyces cerevisiae?

    YDL009C is a putative uncharacterized protein in Saccharomyces cerevisiae that appears to be associated with DNA recombination and repair processes. While its precise function remains to be fully elucidated, research indicates it may play a role in genomic stability. The protein has been studied in genome-wide screens for genes affecting spontaneous direct recombination, suggesting its involvement in DNA metabolism . The association with MSH6, a component of the mismatch repair machinery, suggests potential roles in DNA repair pathways .

  • What experimental techniques are commonly used to study YDL009C expression?

    Multiple molecular biology techniques can be employed to study YDL009C expression:

    • Real-time quantitative PCR (RT-qPCR) using specific probe assays designed for gene expression analysis, such as those available commercially from Bio-Rad

    • Yeast deletion collection studies using synthetic genetic array (SGA) methodology to introduce recombination reporters into strains lacking YDL009C

    • Fluctuation tests to measure recombination events in strains with and without YDL009C, performed according to the Luria-Delbrück method

    • Colony measurement systems using image analysis software such as ImageJ and ScreenMill for quantitative assessment of phenotypes

    For gene expression studies specifically, researchers typically use FAM-labeled fluorescent probes in conjunction with unlabeled PCR primers to detect and quantify YDL009C transcript levels .

  • What phenotypes are associated with YDL009C deletion in yeast?

    YDL009C deletion strains have been studied in genome-wide screens, with the primary observed phenotype being altered rates of spontaneous direct recombination . These deletion strains can be constructed using standard yeast knockout methodologies and assessed through replica-plating on selective media (such as SD-leu) to detect recombination events. The experimental approach typically involves:

    1. Constructing deletion strains with genotype MATa ydl009cΔ::kanMX carrying a leu2DEcoRI-URA3-leu2DBstEII recombination reporter

    2. Streaking these strains on SD-ura media to confirm presence of the reporter

    3. Growing patches on YPD medium for 24 hours at 30°C

    4. Replica-plating to SD-leu to visualize recombination events as papillae

    5. Conducting fluctuation tests to quantify recombination rates

    The YDL009C deletion strain shows quantifiable differences in recombination rates compared to wild-type strains, with measured rates of approximately 2.34E-05 .

  • How is YDL009C related to recombination processes in yeast?

    Research data indicates that YDL009C is associated with DNA recombination processes. In genome-wide screens, YDL009C deletion has been shown to affect recombination rates, with measured rates of approximately 2.34E-05 (p-value: 1.02E-05) . This suggests the protein may normally function in pathways that regulate or constrain spontaneous recombination. To investigate this relationship, researchers typically:

    • Employ the leu2DEcoRI-URA3-leu2DBstEII marker system to measure direct-repeat recombination

    • Conduct fluctuation tests measuring recombination frequencies in wild-type versus deletion strains

    • Analyze colony growth on selective media to identify recombination events

    • Compare recombination rates with those of known recombination regulatory genes

    The connection to MSH6 further suggests potential roles in pathways that maintain genomic stability through regulation of recombination processes .

  • What genetic tools are available for studying YDL009C?

    Several genetic tools and resources are available for studying YDL009C:

    • YDL009C deletion strains from yeast knockout collections (such as EUROSCARF or the systematic yeast deletion collection)

    • Real-time PCR probe assays specifically designed for YDL009C gene expression analysis

    • PCR primers designed to amplify YDL009C for cloning or expression studies

    • Recombination reporter systems (e.g., leu2DEcoRI-URA3-leu2DBstEII) that can be introduced into YDL009C mutant backgrounds

    • SGA methodology for introducing reporters or creating double mutants with YDL009C

    These tools allow researchers to conduct comprehensive genetic analyses of YDL009C function, expression, and interactions with other genes and pathways.

Advanced Research Questions

  • What is the relationship between YDL009C and MSH6 in DNA repair mechanisms?

    The search results indicate an association between YDL009C and MSH6 , suggesting a potential functional relationship in DNA repair pathways. MSH6 is a well-characterized component of the MutSα complex involved in recognizing and repairing DNA mismatches. To thoroughly investigate this relationship, researchers would typically:

    • Perform co-immunoprecipitation experiments to test for physical interactions between YDL009C and MSH6

    • Conduct epistasis analysis by creating double deletion mutants (ydl009cΔ msh6Δ) to determine if they function in the same or parallel pathways

    • Use fluctuation tests to compare recombination rates between single and double mutants

    • Employ fluorescence microscopy with tagged proteins to examine co-localization, especially following DNA damage

    The data from recombination studies showing YDL009C's recombination rate of 2.34E-05 provides a quantitative foundation for these investigative approaches.

  • How does YDL009C deletion affect spontaneous direct recombination rates?

    Based on the search results, YDL009C deletion affects recombination rates in Saccharomyces cerevisiae. Fluctuation tests reveal a recombination rate of 2.34E-05 with a p-value of 1.02E-05 . To methodically study this effect, researchers employ the following approaches:

    • Utilize the Luria-Delbrück fluctuation test methodology with direct-repeat recombination reporters

    • Culture independent colonies to saturation in YPD liquid medium

    • Plate appropriate dilutions on fully supplemented SD plates and on SD-leu plates to detect recombination events

    • Calculate recombination rates using statistical methods such as the method of the median or maximum likelihood

    • Compare these rates with wild-type strains and other known recombination mutants

    This quantitative data is critical for positioning YDL009C within the network of genes affecting genomic stability in yeast.

  • What methodologies are most effective for characterizing protein-protein interactions involving YDL009C?

    To identify and characterize protein-protein interactions involving YDL009C, researchers should employ multiple complementary approaches:

    • Yeast two-hybrid screening using YDL009C as bait to identify potential interacting partners

    • Affinity purification coupled with mass spectrometry (AP-MS) using tagged YDL009C to isolate protein complexes

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

    • Protein co-immunoprecipitation followed by Western blotting to confirm specific interactions

    • In vitro binding assays using purified recombinant proteins to establish direct interactions

    The suggested association with MSH6 provides a specific candidate for targeted interaction studies. Results from these experiments should be integrated with functional data from genetic studies to establish the biological relevance of identified interactions.

  • How can genome-wide approaches be optimized for studying YDL009C function?

    The search results describe several genome-wide approaches used to study YDL009C . To optimize these for more focused functional studies, researchers should consider:

    • Employing arrayed yeast deletion collections in 1536 format, with each strain in quadruplicate as described in the literature

    • Introducing specific reporters through SGA methodology to measure phenotypes of interest beyond recombination, such as DNA damage sensitivity

    • Utilizing automated pinning systems for replica plating onto selective media containing various stressors or DNA-damaging agents

    • Implementing computational image analysis using software like ImageJ and ScreenMill for quantitative assessment of colony growth under various conditions

    • Performing genetic interaction mapping by creating double mutants of YDL009C with other genes of interest

    These approaches should be coupled with rigorous statistical analysis to identify significant phenotypic effects and genetic interactions.

  • What role might YDL009C play in stress response pathways?

    To investigate potential roles of YDL009C in stress response pathways, researchers should design experiments examining expression and functionality under various stress conditions:

    • Perform RT-qPCR using YDL009C-specific probe assays under different stress conditions (oxidative stress, DNA damage, heat shock, nutrient limitation)

    • Create YDL009C promoter-reporter fusions to monitor transcriptional regulation under stress

    • Test sensitivity of YDL009C deletion strains to various stressors using spot dilution assays

    • Compare the transcriptional profile of wild-type and YDL009C deletion strains under stress using RNA-seq

    • Examine localization of tagged YDL009C protein under normal and stress conditions

    These approaches would help determine whether YDL009C functions specifically in DNA metabolism or plays broader roles in cellular stress responses.

  • How can high-throughput screening methods be optimized for studying YDL009C?

    To optimize high-throughput screening for YDL009C studies, researchers should:

    • Design custom synthetic genetic array (SGA) screens focusing on DNA repair, recombination, or specific cellular stress pathways

    • Employ the colony array method described in the literature, where the yeast deletion collection containing recombination reporters is arrayed in 1536 format

    • Pin strains onto multiple condition plates to test various phenotypes simultaneously

    • Use automated imaging systems to capture colony growth at multiple time points

    • Apply sophisticated image analysis using software packages like ImageJ and ScreenMill Colony Measurement Engine

    • Incorporate rigorous statistical methods to account for plate-to-plate variation and identify significant hits

    These optimizations would enable more comprehensive and sensitive detection of YDL009C-related phenotypes across thousands of genetic backgrounds or conditions.

  • What approaches can be used to resolve contradictory data regarding YDL009C function?

    When facing contradictory data about YDL009C function, researchers should:

    • Perform independent validation using multiple methodological approaches

    • Test YDL009C function in different strain backgrounds to account for genetic modifiers

    • Use complementation studies with wild-type YDL009C to confirm phenotypes are specifically due to its absence

    • Create point mutations in functional domains rather than complete gene deletions to distinguish between different aspects of protein function

    • Employ conditional expression systems to study dosage effects and timing requirements

    • Compare results from different screening approaches (e.g., patch screening versus pinning) as mentioned in the literature, where some recombination genes identified in patch screens were not detected in pinning screens

    This multi-faceted approach helps reconcile apparently contradictory results and builds a more complete understanding of YDL009C function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.