Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDL011C (YDL011C)

Shipped with Ice Packs
In Stock

Description

Research Applications and Experimental Findings

While YDL011C’s biological role is undefined, its recombinant form enables exploratory studies:

Protein Interaction and Localization Studies

Large-scale yeast two-hybrid screens identified 957 protein-protein interactions in S. cerevisiae, but YDL011C was not explicitly listed among them . Recent ER tubule isolation studies using Yop1p (a tubule-specific marker) highlighted uncharacterized proteins in membrane trafficking and lipid metabolism, suggesting analogous roles for YDL011C .

Knockout Strain Availability

A YDL011C knockout strain (RNSS-4741291) is available for phenotypic analysis, though no published studies report its use to date . This tool could clarify whether the ORF encodes a functional protein or represents a non-coding sequence.

Immunoassay and Detection Tools

Recombinant YDL011C is used in:

  • ELISA Kits: Quantitative detection of the protein in yeast lysates .

  • Antibody Production: Polyclonal rabbit antibodies for Western blot validation .

Current Challenges and Knowledge Gaps

  • Functional Ambiguity: The YDL011C locus is classified as a dubious ORF due to weak sequence conservation and lack of functional evidence .

  • Experimental Data: No peer-reviewed studies directly linking YDL011C to specific biological pathways or cellular processes exist.

  • Structural Insights: No crystallographic or cryo-EM data are available to infer tertiary structure or binding partners.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
YDL011C; Putative uncharacterized protein YDL011C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDL011C
Target Protein Sequence
MADKLSSTDAMGCWSPTFCFISLISSSTSELPLFVVEVGIAAYSLEDPPAILSILVLNAL EVSSFISTVKKFAFCATKNTNNNNSVVMLKILAFLLLEGIIIKLFLY
Uniprot No.

Target Background

Database Links

STRING: 4932.YDL011C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YDL011C and why is it significant in S. cerevisiae research?

YDL011C is a putative uncharacterized protein in the budding yeast Saccharomyces cerevisiae, a model organism widely used in molecular biology and genetics research. S. cerevisiae has become one of the most utilized model organisms due to its ease of use, economic utility, well-studied genome, and highly conserved proteome across eukaryotes . The significance of studying YDL011C lies in enhancing our understanding of yeast cellular processes, which often have parallels in human biology due to the conservation of many fundamental biological mechanisms across eukaryotes. Research on YDL011C contributes to the broader field of functional genomics, where characterizing previously uncharacterized proteins helps complete our understanding of cellular pathways and networks.

How can I confirm the presence and expression of YDL011C in my yeast strain?

Confirmation of YDL011C presence and expression can be accomplished through several methodological approaches:

  • PCR-based detection: Design specific primers for YDL011C gene amplification. Extract genomic DNA from your strain and perform PCR using designed primers specific to the YDL011C gene. Primers should be synthesized by a reputable biotechnology company and optimized for specificity .

  • Gene expression analysis: To measure expression levels, use real-time PCR probe assays designed for gene expression analysis. These assays typically consist of unlabeled PCR primers and a dual-labeled fluorescent probe (e.g., FAM-labeled) . For YDL011C specifically, commercial assays such as the PrimePCR Probe Assay are available.

  • Colony PCR verification: This can be performed as a rapid screening method to confirm the presence of YDL011C in transformed colonies without the need for genomic DNA extraction .

The PCR reaction mixture should contain appropriate buffer (e.g., 10× Standard Taq Reaction Buffer), Taq polymerase, your extracted DNA sample, and YDL011C-specific primers. Follow standard thermal cycling conditions adapted for the specific length of your target amplicon.

What are the predicted structural and functional properties of YDL011C?

While YDL011C remains largely uncharacterized, bioinformatic analyses can provide insights into its potential structural and functional properties. Protein sequence analysis tools can be used to predict:

  • Subcellular localization: Prediction algorithms can suggest whether YDL011C is likely cytoplasmic, nuclear, mitochondrial, or associated with other cellular compartments.

  • Protein domains and motifs: Search for conserved domains that might indicate function.

  • Secondary structure: Prediction of alpha helices, beta sheets, and disordered regions.

  • Post-translational modification sites: Identification of potential phosphorylation, glycosylation, or other modification sites.

  • Secretion signal analysis: Tools like SignalP-5.0 can be used to determine if YDL011C contains a secretion signal peptide, though many yeast proteins do not have secretion signals .

Based on comparative analysis with other yeast proteins, YDL011C likely does not contain a secretion signal peptide, suggesting it functions intracellularly rather than being secreted to the extracellular environment.

What approaches can be used to characterize the function of YDL011C through genetic manipulation?

Characterizing the function of an uncharacterized protein like YDL011C requires sophisticated genetic manipulation strategies:

  • Gene disruption/knockout: Create YDL011C-deficient strains through deletion-insertion methods. This can be accomplished by replacing the YDL011C gene with a selectable marker such as a gentamicin resistance (GmR) cassette using techniques like HiFi Gibson assembly . The strategy involves:

    • Amplifying N-terminal and C-terminal portions of YDL011C with flanking regions

    • Designing primers with overlapping regions

    • Amplifying a selection marker (e.g., gentamicin resistance cassette)

    • Assembling the fragments to create a construct for homologous recombination

  • Overexpression studies: Clone YDL011C into expression vectors like pBBH1 or pBBH4. The pBBH4 vector carries signals for extracellular secretion of recombinant proteins in S. cerevisiae, which can be useful for functional studies .

  • Yeast-Mediated Ligation (YML): This technique can be used for efficient cloning of YDL011C into expression vectors. The process involves:

    • Linearizing the vector with appropriate restriction enzymes

    • Purifying DNA fragments from agarose gel

    • Using YML and electroporation for transforming yeast cells

  • Gene tagging: Fuse YDL011C with epitope tags or fluorescent proteins to track its localization and interactions within the cell.

  • Conditional expression systems: Place YDL011C under the control of inducible promoters to study dose-dependent effects.

The phenotypic analysis of these genetically modified strains under various conditions can provide insights into YDL011C function.

How can I design experiments to identify protein-protein interactions involving YDL011C?

Identifying protein-protein interactions for YDL011C requires multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) screening: Clone YDL011C as a bait protein fused to a DNA-binding domain and screen against a prey library of S. cerevisiae proteins fused to an activation domain. Interaction between YDL011C and a prey protein will reconstitute a functional transcription factor, activating reporter gene expression.

  • Co-immunoprecipitation (Co-IP): Express tagged versions of YDL011C (with epitopes like HA, FLAG, or Myc) in yeast cells. Use appropriate antibodies to precipitate YDL011C and identify co-precipitated proteins through mass spectrometry.

  • Proximity-dependent labeling: Fuse YDL011C to enzymes like BioID or APEX2 that can biotinylate nearby proteins, allowing for the identification of proximal proteins that may be interacting partners.

  • Mass spectrometry-based approaches: Use label-free quantitative mass spectrometry to identify proteins that differentially associate with YDL011C under various conditions. The method involves:

    • Cell lysis using urea/thiourea buffer (6M urea, 2M thiourea, 50mM ammonium bicarbonate) with protease inhibitors

    • Protein reduction with 10mM dithiothreitol

    • Alkylation with 20mM iodoacetamide

    • Digestion with Lys-C followed by trypsin

    • Peptide purification and mass spectrometric analysis

How can RNA-mediated processes be studied in relation to YDL011C function?

S. cerevisiae provides an excellent model for studying RNA-mediated processes that might involve YDL011C:

  • RNA-protein interaction studies: If YDL011C is suspected to interact with RNA:

    • RNA immunoprecipitation (RIP) can identify RNAs that associate with YDL011C

    • CLIP-seq (Crosslinking and Immunoprecipitation followed by sequencing) can map RNA binding sites at nucleotide resolution

    • RNA electrophoretic mobility shift assays (EMSAs) can confirm direct binding

  • Transcriptome analysis: Compare RNA expression profiles between wild-type and YDL011C-manipulated strains using RNA-seq to identify affected pathways. S. cerevisiae has been extensively used to investigate RNA-based mechanisms in various human diseases, making this approach particularly valuable .

  • Translation regulation studies: If YDL011C affects protein synthesis:

    • Polysome profiling can assess translation efficiency

    • Ribosome profiling can map ribosome positions on mRNAs

    • In vitro translation assays can directly measure effects on protein synthesis

  • RNA stability assays: Measure half-lives of specific transcripts in the presence or absence of functional YDL011C using transcription inhibition followed by RT-qPCR at various time points.

S. cerevisiae has been instrumental in investigating RNA-based processes involved in various human diseases, suggesting that research on YDL011C could have broader implications beyond basic yeast biology .

What are the most effective methods for expressing recombinant YDL011C protein?

The expression of recombinant YDL011C can be optimized through several methodological approaches:

Table 1: Comparison of Expression Systems for Recombinant YDL011C Production

Expression SystemAdvantagesDisadvantagesOptimal For
Native S. cerevisiaeNatural post-translational modifications, proper foldingLower yields than specialized systemsFunctional studies requiring native modifications
Engineered S. cerevisiae strainsHigher expression levels, controlled inductionAdditional genetic manipulation requiredLarge-scale protein production
E. coliRapid growth, high yields, simple mediaMay lack proper yeast-specific modificationsStructural studies requiring large amounts of protein
Pichia pastorisHigh-density cultures, strong promotersLonger development timeSecreted expression with glycosylation

For yeast-based expression:

  • Clone the YDL011C gene into appropriate expression vectors like pBBH1 (intracellular expression) or pBBH4 (for secretion) .

  • Optimize codon usage for high expression if necessary.

  • Transform into appropriate S. cerevisiae strains using established protocols such as the lithium acetate method or electroporation.

  • For secreted expression, verify that YDL011C lacks a native secretion signal and include the XYNSEC signal from the pBBH4 vector to enable extracellular secretion .

  • Induce expression using appropriate conditions for the chosen promoter system (e.g., GAL1 promoter induced by galactose).

  • Verify expression through Western blotting using antibodies against YDL011C or an epitope tag if incorporated.

What protocols should be followed for purification and characterization of YDL011C?

Purification and characterization of YDL011C requires a multi-step approach:

  • Cell lysis and extract preparation:

    • For intracellular YDL011C: Use urea/thiourea lysis buffer (6M urea, 2M thiourea, 50mM ammonium bicarbonate) with protease inhibitors

    • Disrupt cells through sonication on ice with multiple rounds to ensure complete lysis

    • Clarify lysate by centrifugation (20,000g, 30 min, 4°C)

  • Protein purification strategies:

    • Affinity chromatography if using tagged YDL011C (His-tag, GST-tag)

    • Ion exchange chromatography based on predicted isoelectric point

    • Size exclusion chromatography for final polishing and determination of oligomeric state

    • For secreted YDL011C: Direct purification from culture medium may be possible

  • Protein characterization:

    • SDS-PAGE to assess purity and apparent molecular weight

    • Mass spectrometry for accurate mass determination and post-translational modification analysis

    • Circular dichroism spectroscopy for secondary structure analysis

    • Limited proteolysis to identify stable domains

    • Thermal shift assays to assess stability and identify stabilizing conditions

  • Functional assays:

    • Develop assays based on predicted function or screening approaches

    • Assess interactions with potential binding partners

    • Investigate enzymatic activity if predicted by sequence analysis

How can I analyze contradictory findings in YDL011C research literature?

Analyzing contradictions in research findings related to YDL011C requires systematic approaches:

  • Context analysis: Many apparent contradictions in the biomedical literature arise from incompletely specified experimental contexts . When evaluating seemingly contradictory results about YDL011C, carefully analyze differences in:

    • Species and strain backgrounds used

    • Temporal contexts of experiments

    • Environmental conditions (temperature, media composition, pH)

    • Specific constructs and tags used for YDL011C

  • Normalization issues: Ensure proper normalization of gene/protein identifiers to account for lexical variability . YDL011C may be referenced by different identifiers or names across publications.

  • Relation type categorization: Categorize findings into relation types (excitatory, inhibitory, association) to identify the specific nature of contradictions .

  • Experimental validation: Design experiments to directly test contradictory claims under controlled conditions that account for the variables identified in context analysis.

  • Systematic review approach: Use a structured approach similar to that described by Alamri and Stevenson, where claims are extracted from relevant literature and systematically compared to identify genuine contradictions versus context-dependent differences .

The polarity of claims (positive vs. negative) about YDL011C function or interactions should be explicitly evaluated, as this has been shown to be useful in identifying genuine contradictions in biomedical literature .

How can YDL011C research contribute to understanding human disease mechanisms?

S. cerevisiae has proven valuable for studying complex human diseases due to the high conservation of fundamental cellular processes . YDL011C research may contribute through:

  • Ortholog identification: Identify potential human orthologs of YDL011C through bioinformatic analyses to suggest potential disease relevance.

  • Disease modeling: If YDL011C is involved in conserved cellular pathways, insights from its function could inform understanding of human diseases, particularly those involving similar protein families or pathways.

  • Translational research potential: S. cerevisiae has been used to study an array of complex human diseases including:

    • Neurodegenerative disorders (through modeling protein aggregation and toxicity)

    • Cancer (by studying cell cycle regulation and genomic instability)

    • Metabolic disorders (via conserved metabolic pathways)

    • Infectious diseases including SARS-CoV-2 (by expressing viral proteins in yeast)

  • RNA-based disease mechanisms: If YDL011C is involved in RNA metabolism or regulation, it could provide insights into RNA-mediated disease processes. Yeast has been utilized to investigate mechanisms ranging from aberrant RNA-binding proteins in amyotrophic lateral sclerosis to translation regulation in cancer .

What are the most promising computational approaches for predicting YDL011C function?

Modern computational approaches offer powerful tools for predicting functions of uncharacterized proteins like YDL011C:

  • Sequence-based predictions:

    • Profile hidden Markov models to detect remote homology

    • Position-specific scoring matrices for motif identification

    • Deep learning approaches trained on protein sequences

  • Structural bioinformatics:

    • Homology modeling to predict 3D structure based on related proteins

    • Ab initio structure prediction using methods like AlphaFold2

    • Structure-based function prediction through binding site analysis

  • Systems biology approaches:

    • Gene co-expression network analysis to identify functional modules

    • Protein-protein interaction network analysis to infer function through guilt-by-association

    • Metabolic network analysis if YDL011C is suspected to have enzymatic function

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving genes

    • Evolutionary rate analysis to detect selective pressures

    • Comparative genomics across yeast species

  • Integrative approaches:

    • Bayesian integration of multiple data types

    • Machine learning models trained on diverse functional genomics datasets

    • Text mining of scientific literature for existing knowledge

These computational predictions should guide experimental design, creating a virtuous cycle between in silico and wet lab approaches.

How can CRISPR/Cas9 technology be optimized for YDL011C studies in S. cerevisiae?

CRISPR/Cas9 has revolutionized genetic manipulation in many organisms, including S. cerevisiae, and can be optimized for YDL011C studies:

  • Guide RNA design:

    • Design sgRNAs targeting YDL011C with minimal off-target effects

    • Consider the GC content and secondary structure of potential sgRNAs

    • Target PAM sites that are unique to YDL011C in the yeast genome

  • Delivery methods:

    • Transform yeast with plasmids expressing Cas9 and sgRNA

    • Include repair templates for precise modifications

    • Consider transient expression systems to minimize off-target effects

  • CRISPR applications for YDL011C:

    • Gene knockout through non-homologous end joining

    • Precise mutations via homology-directed repair

    • CRISPRi for transcriptional repression without DNA cleavage

    • CRISPRa for transcriptional activation to study overexpression phenotypes

    • Base editing for introducing specific point mutations without double-strand breaks

  • Validation strategies:

    • PCR and sequencing to confirm desired modifications

    • Whole-genome sequencing to assess off-target effects

    • Expression analysis to confirm functional consequences

    • Phenotypic assays to validate functional impacts

  • Multiplexed CRISPR approaches:

    • Simultaneously target YDL011C and potential interacting partners

    • Create combinatorial genetic modifications to study genetic interactions

What are the key technical challenges in researching YDL011C and how can they be addressed?

Researching an uncharacterized protein like YDL011C presents several technical challenges:

  • Functional assignment: Without known function, designing appropriate assays is difficult. This can be addressed through:

    • Systematic phenotypic screening of YDL011C mutants under various conditions

    • Omics approaches (proteomics, transcriptomics, metabolomics) to identify cellular pathways affected by YDL011C manipulation

    • High-throughput screening for potential substrates or interacting partners

  • Protein expression and stability: If YDL011C is difficult to express or unstable, consider:

    • Testing multiple expression systems and conditions

    • Co-expression with potential stabilizing partners

    • Expression of stable domains identified through bioinformatics

  • Antibody availability: For an uncharacterized protein, specific antibodies may not be commercially available. Solutions include:

    • Generating custom antibodies against YDL011C peptides or recombinant protein

    • Using epitope tagging approaches

    • Expressing YDL011C fusion proteins with easily detectable tags

  • Contradictory findings interpretation: Address through rigorous context analysis and standardized experimental conditions as outlined in section 3.3.

  • Relating yeast findings to higher organisms: Establish clear orthology relationships and validate key findings in more complex models when possible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.