Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDL026W (YDL026W)

Shipped with Ice Packs
In Stock

Description

Overview and Nomenclature

YDL026W is a gene product from Saccharomyces cerevisiae (baker’s yeast) strain S288C. Its official name reflects its classification as a "putative uncharacterized protein," indicating insufficient functional data to assign specific biological roles. Key identifiers include:

AttributeValueSource
Gene NameYDL026W
SynonymsPutative uncharacterized protein YDL026W
UniProt IDQ12147
Protein LengthFull length: 1–103 amino acids (aa)

Recombinant Production and Characteristics

YDL026W is produced via heterologous expression in diverse host systems, yielding recombinant proteins with varying tags and purities. Table 1 summarizes key product specifications:

Product FeatureDetailsSource
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
TagsHis-tag (N-terminal) or untagged
Purity≥85% (SDS-PAGE) for partial/full-length proteins; >90% for full-length
FormLyophilized powder (with trehalose) or liquid (with glycerol)
ApplicationsELISA, Western blot (antibodies), structural studies

Example Product Specifications (Full-Length YDL026W):

ParameterValueSource
HostE. coli
TagHis-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0

Biochemical Properties

While experimental data on YDL026W’s function is limited, its physicochemical properties are well-documented:

  • Molecular Weight: Not explicitly stated in sources, but inferred from sequence length (103 aa ≈ 11.6 kDa).

  • Isoelectric Point (pI): Calculated from the amino acid sequence (e.g., using software like ExPASy).

  • Abundance: Median protein abundance data for S. cerevisiae strains is available in SGD but not explicitly cited here.

  • Domains: No conserved domains or motifs reported in SGD or commercial datasets, reinforcing its uncharacterized status.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
YDL026W; Putative uncharacterized protein YDL026W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDL026W
Target Protein Sequence
MHESLRNWKLSPRYFGIAGDVIAEGTGLGKALNIPGKYILKPFPLLRLLSVTLFISSLVL LANPTGTLNIFSYSYVVMVVLFICAKSLFNYSLQFIGEETSSL
Uniprot No.

Target Background

Database Links

STRING: 4932.YDL026W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the general structure and composition of YDL026W protein?

When working with this protein, researchers typically use recombinant versions expressed in E. coli with an N-terminal His-tag to facilitate purification . The recombinant protein maintains the full amino acid sequence integrity of the native protein while adding the His-tag for purification purposes.

What expression systems are most effective for producing recombinant YDL026W?

While E. coli remains the predominant expression system for YDL026W as evidenced by commercial preparations , the methodology for optimal expression requires careful consideration. For bacterial expression, BL21(DE3) strains with pET-based vectors under T7 promoter control typically yield sufficient protein quantities for most research applications.

The methodology for expression optimization includes:

  • Temperature modulation (16-30°C) during induction to balance protein yield with correct folding

  • IPTG concentration titration (0.1-1.0 mM) for induction

  • Growth media supplementation with additional trace elements if required

  • Post-induction expression time optimization (4-24 hours)

For researchers requiring native post-translational modifications, expression in S. cerevisiae itself using galactose-inducible promoters may be preferable, although yields are typically lower than bacterial systems.

What are the recommended storage and handling conditions for purified YDL026W protein?

For optimal stability and activity retention, purified YDL026W protein should be stored following specific guidelines. The protein is typically supplied in lyophilized form and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . After reconstitution, the addition of glycerol to a final concentration of 5-50% is recommended for long-term storage stability .

Storage recommendations include:

  • For long-term storage: -20°C to -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

It's critical to avoid repeated freeze-thaw cycles as they significantly reduce protein activity and structural integrity. Brief centrifugation of vials prior to opening is also recommended to ensure all lyophilized protein is collected at the bottom of the container .

How can researchers effectively design experiments to characterize the function of YDL026W?

Characterizing uncharacterized proteins like YDL026W requires a multi-faceted experimental approach. A comprehensive research strategy should include:

Genomic Context Analysis:
Begin by examining the genomic neighborhood of YDL026W within the S. cerevisiae genome to identify potential functional associations with adjacent genes. This contextual analysis can provide initial clues about function based on the principle that functionally related genes often cluster together in the genome.

Protein Interaction Studies:
Implementing affinity purification coupled with mass spectrometry (AP-MS) or yeast two-hybrid (Y2H) screens can identify protein interaction partners. For YDL026W, optimization of bait constructs is essential since membrane-associated proteins can pose technical challenges in Y2H systems. Using both N-terminal and C-terminal tagging approaches can mitigate potential interference with protein-protein interactions.

Gene Deletion/Knockout Analysis:
Since S. cerevisiae has a comprehensive deletion mutant collection covering approximately 90% of the genome , researchers can leverage these resources to examine phenotypes associated with YDL026W deletion. Phenotypic assays should include:

  • Growth rate analysis under various stress conditions (oxidative, osmotic, temperature)

  • Microscopic examination of cellular morphology and organelle distribution

  • Metabolic profiling using mass spectrometry

  • Transcriptomic analysis to identify compensatory responses

Complementation Studies:
For validation of phenotypes, complementation with wild-type YDL026W should be performed, preferably using both constitutive and native promoter expression systems to control for potential dosage effects.

What methodologies can be employed to study potential post-translational modifications of YDL026W?

As a putative membrane-associated protein, YDL026W may undergo various post-translational modifications (PTMs) that influence its localization, stability, or function. A systematic approach to characterizing PTMs includes:

Mass Spectrometry-Based Approaches:
High-resolution mass spectrometry following tryptic digestion represents the gold standard for PTM identification. For YDL026W specifically:

  • Enrichment strategies for phosphopeptides (TiO₂, IMAC) should be employed to detect potential phosphorylation events

  • Hydrophilic interaction liquid chromatography (HILIC) can be used to enrich glycopeptides if glycosylation is suspected

  • Multiple fragmentation techniques (CID, HCD, ETD) should be utilized to maximize PTM coverage

Site-Directed Mutagenesis:
Following identification of potential PTM sites, site-directed mutagenesis of these residues (e.g., changing Ser/Thr to Ala to prevent phosphorylation) can help establish the functional significance of these modifications. Expression of these mutants in YDL026W-deficient strains can reveal phenotype changes associated with specific PTMs.

In vivo Labeling:
For dynamic studies of PTMs, metabolic labeling approaches using stable isotopes can track modification kinetics. For example, ³²P-orthophosphate labeling can monitor phosphorylation dynamics in response to various cellular stresses or cell cycle stages.

How can researchers effectively integrate YDL026W studies with global genetic interaction networks in S. cerevisiae?

S. cerevisiae offers powerful tools for mapping genetic interactions, with comprehensive datasets covering approximately 75% of all genes in the organism . For integrating YDL026W into these networks:

Synthetic Genetic Array (SGA) Analysis:
This powerful technique systematically creates double mutants combining YDL026W deletion with deletions of other non-essential genes. The resulting fitness profiles can place YDL026W within specific cellular pathways based on genetic interaction patterns. Key methodological considerations include:

  • Use of both deletion and hypomorphic alleles of YDL026W

  • Implementation of quantitative fitness measurements rather than binary growth/no-growth assessments

  • Statistical analysis comparing observed fitness to expected multiplicative effects

Comparative Interaction Profiling:
Analysis of similarity between the genetic interaction profile of YDL026W and profiles of genes with known functions can suggest functional relationships. This approach successfully identified previously unknown components of cellular processes in yeast . For YDL026W research, comparison with interaction profiles of membrane protein biogenesis pathways may be particularly informative.

Data Integration Frameworks:
Combining genetic interaction data with other -omics datasets (transcriptomics, proteomics, metabolomics) provides a more comprehensive understanding of YDL026W function. Bayesian network approaches can integrate these diverse data types to generate testable hypotheses about YDL026W function.

What are the recommended protocols for studying YDL026W in the context of yeast aging research?

Given the extensive use of S. cerevisiae in aging research , investigating YDL026W's potential role in this process requires careful experimental design:

Replicative Lifespan (RLS) Analysis:
RLS measures the number of cell divisions a mother cell undergoes before senescence. For YDL026W studies:

  • Microdissection Approach: Individual cells are monitored under a microscope, with daughter cells removed after each division using a micromanipulator. For YDL026W-deletion strains compared to wild-type, a minimum of 40 mother cells should be analyzed to achieve statistical power.

  • Mother Enrichment Program (MEP): This genetic system allows selective killing of daughter cells, facilitating enrichment of aging mother cells for biochemical analysis. This approach is particularly valuable for studying molecular changes in YDL026W expression or localization during aging.

Chronological Lifespan (CLS) Analysis:
CLS measures survival in a non-dividing, stationary phase state. Protocol considerations include:

  • Media composition standardization (especially glucose concentration, which significantly impacts CLS)

  • Cell viability assessment methods (colony formation versus vital dye staining)

  • Sampling frequency optimization to capture the survival curve accurately

A comprehensive experimental design should include both RLS and CLS measurements to determine if YDL026W influences specific aspects of yeast aging. Additionally, gene expression analysis of YDL026W during aging processes can provide insights into its temporal regulation.

What techniques are most effective for studying potential membrane association of YDL026W?

Based on sequence analysis suggesting hydrophobic regions, YDL026W may be membrane-associated. Investigating this aspect requires specialized methodologies:

Subcellular Fractionation:
Differential centrifugation coupled with membrane flotation assays can separate cellular components based on density and membrane association. For YDL026W studies:

  • Sequential centrifugation steps (1,000g → 10,000g → 100,000g) separate nuclei, organelles, and microsomes

  • Equilibrium density gradients using sucrose or Percoll can further resolve membrane fractions

  • Western blotting with anti-His antibodies (for recombinant protein) or anti-YDL026W antibodies (for native protein) can track the protein across fractions

Fluorescence Microscopy:
Fusion of YDL026W with fluorescent proteins (GFP, mCherry) allows visualization of its subcellular localization. Methodological considerations include:

  • Both N- and C-terminal fusions should be constructed to minimize interference with targeting signals

  • Co-localization with known organelle markers (e.g., ER-Tracker, MitoTracker)

  • Live-cell imaging to capture dynamic localization changes

Membrane Topology Mapping:
For proteins embedded in membranes, determining the orientation of domains relative to the membrane is critical:

  • Protease protection assays using isolated membrane fractions

  • Glycosylation site insertion coupled with mobility shift analysis

  • Cysteine accessibility methods using membrane-impermeable sulfhydryl reagents

What are the recommended methods for extracting and analyzing circular DNA associated with YDL026W studies in aging yeast populations?

Recent research indicates that circular DNA elements may play important roles in yeast aging . For studying potential associations between YDL026W and circular DNA:

Extraction Protocol:
The following methodology optimizes circular DNA isolation from yeast:

  • Cell wall digestion with Zymolyase until cells burst when exposed to hypo-osmotic stress

  • Cellular lysis using Qiagen P1 and P2 buffers

  • Linear DNA elimination through extended exonuclease treatment (six days with fresh enzyme addition every 24 hours)

  • Concentration of remaining circular DNA through vacuum centrifugation

  • Amplification using REPLI-g Mini for 40 hours

Quality Control Measures:
To ensure circular DNA integrity and purity:

  • Internal plasmid spike controls at known concentrations (e.g., pUG72, pUC19-yEGFP)

  • Verification of linear DNA elimination through gel electrophoresis

  • Quantification using fluorometric methods (Qubit) rather than spectrophotometric methods

Analytical Approaches:
For comprehensive characterization of isolated circular DNA:

  • Next-generation sequencing with specialized bioinformatic pipelines designed to identify circular elements

  • Quantitative PCR targeting YDL026W sequences to determine if they are enriched in circular DNA fractions

  • Long-read sequencing (Oxford Nanopore or PacBio) to resolve complex circular structures

How should researchers interpret conflicting data regarding YDL026W function across different experimental systems?

As an uncharacterized protein, research on YDL026W may yield seemingly contradictory results across different experimental platforms. A systematic approach to data reconciliation includes:

Strain Background Considerations:
S. cerevisiae laboratory strains (S288C, W303, BY4741) have significant genetic differences that can influence experimental outcomes. Methodological approaches to address this include:

  • Testing phenotypes in multiple genetic backgrounds

  • Complementation testing across strain backgrounds

  • Creation of hybrid backgrounds to identify potential modifiers

Expression Level Analysis:
Overexpression versus endogenous expression can yield dramatically different results. Quantitative assessment should include:

  • Western blot quantification calibrated against known standards

  • qRT-PCR measurement of transcript levels

  • Single-cell analysis to account for population heterogeneity

Integration of Multiple Data Types:
When conflicting data emerges, data integration strategies become essential:

Data TypeWeight in AnalysisCommon Confounding Factors
Genetic interactionsHighSynthetic effects, suppression
Physical interactionsMedium-HighTag interference, non-specific binding
Localization studiesMediumTag size, overexpression artifacts
Transcriptional responsesMedium-LowSecondary effects, timing issues
Computational predictionsLowAlgorithm biases, incomplete databases

Rigorous statistical approaches, including meta-analysis methodologies when sufficient studies exist, should be applied to integrate these data sources.

What computational approaches can predict potential functions of YDL026W based on its sequence and structural features?

For uncharacterized proteins like YDL026W, computational predictions can guide experimental design:

Sequence-Based Approaches:
Multiple sequence alignment and conservation analysis across fungal species can identify conserved residues likely critical for function. Methodology includes:

  • BLAST searches against fungal genomes with varying evolutionary distances from S. cerevisiae

  • Progressive multiple sequence alignment using MUSCLE or MAFFT algorithms

  • Conservation scoring using methods like Jensen-Shannon divergence

  • Identification of conserved motifs using MEME suite

Structural Prediction:
In the absence of crystal structures, computational modeling can predict structural features:

  • Secondary structure prediction using consensus methods (JPred, PSIPRED)

  • Transmembrane domain prediction using TMHMM, Phobius

  • Ab initio 3D structure prediction using AlphaFold2 or RoseTTAFold

  • Model quality assessment using MolProbity scores and Ramachandran analysis

Functional Inference:
Integration of structural and sequence information can suggest functions:

  • Identification of functional domains through InterProScan

  • Structure-based function prediction using ProFunc servers

  • Ligand binding site prediction using metaPocket

  • Protein-protein interaction surface prediction using SPPIDER

What methodological approaches are recommended for studying YDL026W in the context of DNA repair and recombination pathways?

S. cerevisiae is a key model for studying DNA repair mechanisms , and understanding YDL026W's potential role requires specialized approaches:

DNA Damage Sensitivity Assays:
Comparing wild-type and YDL026W-deficient strains for sensitivity to DNA-damaging agents:

  • UV irradiation (primarily induces thymine dimers)

  • Methyl methanesulfonate (alkylating agent)

  • Hydroxyurea (replication stress inducer)

  • Ionizing radiation (double-strand breaks)

Recombination Rate Measurement:
Quantitative assessment of recombination frequencies:

  • Direct-repeat recombination assays using integrated reporter constructs

  • Sister chromatid exchange visualization using chromosome-specific FISH probes

  • Meiotic recombination mapping using tetrad analysis with visible markers

DNA Repair Kinetics:
Temporal resolution of repair processes:

  • Chromatin immunoprecipitation (ChIP) to measure recruitment of YDL026W to damage sites

  • Comet assay to measure DNA break persistence

  • Southern blot analysis to track repair of specific induced lesions

  • Live-cell imaging with fluorescently tagged repair proteins to measure co-localization kinetics

This methodological framework allows for comprehensive assessment of YDL026W's potential involvement in various DNA repair pathways, contextualizing its role within the well-established yeast DNA repair network.

What emerging technologies will advance our understanding of YDL026W function?

The study of uncharacterized proteins like YDL026W will benefit from several cutting-edge methodologies:

CRISPR-Based Approaches:
While traditional gene deletion has been the standard in yeast genetics, CRISPR systems offer new possibilities:

  • CRISPRi for tunable gene repression rather than complete deletion

  • CRISPR activation systems for endogenous gene upregulation

  • Base editing for introducing specific mutations without double-strand breaks

  • Prime editing for precise sequence modifications

Single-Cell Technologies:
Understanding cell-to-cell variability in YDL026W expression and function:

  • Single-cell RNA-seq to capture transcriptional heterogeneity

  • Single-cell proteomics using mass cytometry

  • Microfluidic platforms for long-term single-cell tracking

  • Single-cell metabolomics to link YDL026W to metabolic phenotypes

Spatial Transcriptomics and Proteomics:
Resolving the spatial context of YDL026W function:

  • Multiplexed FISH for subcellular mRNA localization

  • Proximity labeling techniques (BioID, APEX) to map protein neighborhoods

  • Super-resolution microscopy for precise localization within membrane microdomains

  • Correlative light and electron microscopy for structural context

These emerging technologies will provide unprecedented resolution in studying YDL026W function, enabling researchers to move beyond population averages to understand its role at the single-cell and subcellular levels.

Why is continued research on uncharacterized proteins like YDL026W important for advancing yeast biology?

Despite decades of research on S. cerevisiae as a model organism, a significant portion of its proteome remains uncharacterized, including YDL026W. The systematic study of these proteins is essential for several reasons:

  • Complete understanding of cellular systems requires knowledge of all components and their interactions

  • Uncharacterized proteins often represent novel functions that expand our understanding of basic biology

  • S. cerevisiae remains the most genetically tractable eukaryotic model with direct relevance to human cell biology

  • Methodologies developed for studying proteins like YDL026W can be applied to other challenging proteins

Comprehensive characterization of YDL026W will contribute to the broader goal of creating a complete functional map of the yeast cell . This knowledge not only advances basic science but also supports biotechnological applications and provides insights into conserved processes relevant to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.