Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDL041W (YDL041W)

Shipped with Ice Packs
In Stock

Description

Basic Protein Information

YDL041W is a protein encoded within the Saccharomyces cerevisiae genome, commonly known as baker's yeast. This protein is currently designated as "putative uncharacterized," indicating that while its sequence has been determined, its precise physiological function remains to be fully elucidated. YDL041W has been cataloged in protein databases with the UniProt identifier Q12352 and is sometimes referred to by its alternative designation D2717 . The protein consists of 117 amino acid residues, making it a relatively small protein within the yeast proteome . While YDL041W lacks a clearly defined human orthologue, its study may nonetheless provide valuable insights into conserved cellular processes across eukaryotes .

Recombinant Expression Systems

Recombinant YDL041W has been successfully expressed in Escherichia coli expression systems, demonstrating the feasibility of producing this yeast protein in bacterial hosts for research purposes . The recombinant form has been engineered to include an N-terminal histidine tag (His-tag), which facilitates protein purification through affinity chromatography techniques and potentially provides a means for detection in experimental settings . This approach to producing YDL041W enables researchers to obtain sufficient quantities of the protein for biochemical and structural studies, despite its relatively low natural abundance in yeast cells.

Potential Cellular Roles

While YDL041W remains largely uncharacterized, genome-wide analyses have begun to provide clues about its potential cellular functions. Notably, YDL041W has been implicated in processes related to chromatin remodeling and histone exchange, suggesting a possible role in gene expression regulation . This functional categorization emerged from comprehensive screening studies examining the effects of gene deletions on various cellular processes. The deletion of YDL041W does not appear to result in respiratory deficiency, indicating that the protein is not essential for mitochondrial function or energy metabolism under standard laboratory conditions .

Involvement in Protein Aggregation Processes

A significant finding regarding YDL041W comes from studies investigating intracellular protein aggregation, particularly in relation to amyloid-beta (Aβ) peptides, which are relevant to Alzheimer's disease research. In experiments where Aβ42-GFP fusion proteins were expressed in yeast deletion mutants, the YDL041W deletion strain exhibited a distinctive "multiple small puncta" localization pattern for the Aβ42-GFP fusion . This observation suggests that YDL041W may normally play a role in preventing or regulating protein aggregation, as its absence appears to alter the distribution pattern of aggregation-prone proteins within the cell.

The following table summarizes these findings in context with other proteins involved in chromatin remodeling:

Open reading frame/gene nameAβ42-GFP localization patternRespiratory deficiencyHuman orthologue
CHD1CytosolicNoCHD2
HIR1Single small punctateNoHIRA
HTA2Single small punctateNoH2AFX
SWC5Single small punctateNoCFDP1
SWR1Multiple punctaNo-
VPS71Multiple small punctaNo-
VPS72Cytosolic with single large punctateNo-
YDL041WMultiple small punctaNo-

This comparative analysis places YDL041W within a functional context, highlighting its potential relationships to other proteins involved in chromatin dynamics and protein localization patterns .

YDL041W in Proteome-Wide Studies

The availability of recombinant YDL041W facilitates its inclusion in broader proteome-wide studies aimed at characterizing the yeast interactome and functional networks. The yeast proteome has been extensively studied, with analysis revealing expression levels ranging from 0.3 to over 200 transcripts per cell for various genes . While specific expression data for YDL041W was not provided in the search results, such proteome-wide studies have identified numerous previously uncharacterized genes, contributing to our understanding of the complete set of proteins expressed in yeast .

Experimental Approaches for Functional Characterization

Given the limited knowledge about YDL041W's function, several experimental approaches could be employed to further elucidate its role:

  1. Protein-protein interaction studies using techniques such as yeast two-hybrid screens or co-immunoprecipitation could identify binding partners, potentially placing YDL041W within known protein complexes or pathways.

  2. Subcellular localization studies using fluorescently-tagged YDL041W could provide insights into its cellular distribution and potential functional compartmentalization.

  3. Structural analyses through X-ray crystallography or nuclear magnetic resonance spectroscopy could reveal the three-dimensional structure of YDL041W, potentially suggesting functional domains based on structural homology to better-characterized proteins.

  4. Phenotypic characterization of YDL041W deletion or overexpression strains under various stress conditions might reveal condition-specific functions not apparent under standard growth conditions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are standardly shipped with regular blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
YDL041W; D2717; Putative uncharacterized protein YDL041W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDL041W
Target Protein Sequence
MIGPLGVSGFKTSLDIDTTEAADTAKGSMSLVGLSSIDATSPSAALVCPSGSVVLVSLKE SGCATFIFLCEGSSLFIMSSGCFLIASLSCVGLTVFETLFSLVFDTAYFICGMVIQL
Uniprot No.

Target Background

Database Links

STRING: 4932.YDL041W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YDL041W and why is it classified as a "putative uncharacterized protein"?

YDL041W is a protein encoded by the YDL041W gene in Saccharomyces cerevisiae (baker's yeast). It is classified as "putative uncharacterized" because while its sequence has been identified through genomic analysis, its specific molecular function and role in cellular processes remain largely unknown. The term "putative" indicates that bioinformatic analysis suggests it is a protein-coding gene, but experimental validation of its function is still limited. According to current classification systems for gene characterization, YDL041W falls into the "Uncharacterized" category, meaning very little is known about its function beyond sequence data .

How can researchers obtain recombinant YDL041W for laboratory studies?

Researchers can obtain recombinant YDL041W through several approaches:

  • Commercial sources: Recombinant full-length His-tagged YDL041W expressed in E. coli is available commercially as a lyophilized powder .

  • In-house production: The YDL041W gene can be amplified from S. cerevisiae genomic DNA using PCR with appropriate primers, cloned into an expression vector (similar to methods used for other yeast genes like ari1), and expressed in E. coli .

For optimal reconstitution of commercially obtained protein, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles which can compromise protein integrity

What expression systems are most suitable for producing recombinant YDL041W?

  • E. coli expression: Advantages include high yield, rapid growth, and cost-effectiveness. The demonstrated success with His-tagged versions suggests proper folding can be achieved. Storage conditions for the purified protein should include 6% trehalose in Tris/PBS-based buffer at pH 8.0 .

  • Homologous expression in S. cerevisiae: May provide more native post-translational modifications and folding environment. Similar approaches to those used for other yeast genes (such as ari1) could be adapted, using vectors like pGAPZαC with appropriate selection markers .

  • Other eukaryotic systems: For functional studies requiring eukaryotic post-translational modifications, systems such as Pichia pastoris or mammalian cell lines could be considered, though these have not been widely reported for YDL041W.

What computational approaches can be applied to predict potential functions of YDL041W?

Advanced computational approaches for predicting YDL041W functions include:

  • Sequence homology analysis: While basic homology searches may not yield clear results for uncharacterized proteins, sensitive methods like PSI-BLAST, HHpred, or HHblits can detect remote homologies not identifiable by conventional BLAST.

  • Structural prediction and modeling: Using tools like AlphaFold2 or RoseTTAFold to predict the three-dimensional structure of YDL041W can provide insights into potential functional domains and binding sites.

  • Functional annotation frameworks: Applying the categorization approach similar to that used for E. coli's y-ome, where genes are classified as "Well-characterized," "Partially characterized," or "Uncharacterized" based on experimental evidence and computational predictions .

  • Contextual genomic analysis: Examining the genomic context of YDL041W in S. cerevisiae and related species for synteny, co-expression patterns, and evolutionary conservation to identify potential functional associations.

  • Protein interaction network prediction: Using tools that predict protein-protein interactions based on structural features, co-expression data, and evolutionary conservation.

For YDL041W, which currently falls into the "Uncharacterized" category, these computational approaches could provide the first clues to guide experimental characterization efforts.

How can researchers conduct comprehensive functional characterization studies of YDL041W?

A systematic approach to characterizing YDL041W function would include:

  • Gene knockout/knockdown studies:

    • Creating YDL041W deletion strains in S. cerevisiae

    • Performing phenotypic analysis under various growth conditions

    • Assessing cellular responses to different stressors (oxidative, osmotic, heat)

  • Protein localization studies:

    • Generating GFP-fusion constructs to track subcellular localization

    • Conducting immunofluorescence microscopy using anti-His antibodies for the recombinant protein

    • Performing subcellular fractionation followed by Western blotting

  • Interaction partner identification:

    • Conducting yeast two-hybrid screens

    • Performing co-immunoprecipitation with His-tagged YDL041W

    • Using proximity labeling approaches such as BioID or APEX

  • Expression analysis:

    • Examining transcriptional responses under different conditions using RT-PCR

    • Conducting Western blotting to assess protein expression levels

    • Using techniques similar to those applied for monitoring ari1 expression in engineered S. cerevisiae strains

  • Structural studies:

    • Circular dichroism spectroscopy for secondary structure assessment

    • X-ray crystallography or cryo-EM for high-resolution structure determination

    • NMR studies for dynamics and potential binding partners

What challenges exist in distinguishing between direct and indirect effects in YDL041W functional studies?

When studying an uncharacterized protein like YDL041W, researchers face several methodological challenges:

  • Pleiotropy vs. direct effects: Gene deletion may cause multiple phenotypic changes, making it difficult to determine which are directly related to YDL041W function versus downstream effects.

  • Compensatory mechanisms: S. cerevisiae may activate compensatory pathways when YDL041W is deleted, masking the true phenotype.

  • Condition-specific functions: YDL041W may only demonstrate phenotypes under specific environmental conditions not typically tested in standard laboratory settings.

  • Redundancy: Functional redundancy with other proteins may obscure phenotypes in single-gene deletion studies.

To address these challenges, researchers should:

  • Employ conditional expression systems rather than complete knockouts

  • Use multiple complementary approaches (genetic, biochemical, cellular)

  • Perform epistasis analysis with genes in related pathways

  • Consider time-resolved studies to distinguish primary from secondary effects

  • Use quantitative phenotyping approaches with appropriate statistical analysis

How can researchers reconcile conflicting data regarding YDL041W function or localization?

When faced with conflicting experimental results regarding YDL041W:

  • Methodology assessment: Examine differences in experimental approaches, including:

    • Expression system differences (E. coli vs. S. cerevisiae)

    • Tag position effects (N-terminal vs. C-terminal tags)

    • Buffer composition and storage conditions

  • Strain-specific variations: Consider whether different S. cerevisiae strains were used, as genetic background can influence protein function and phenotypes.

  • Integrated data analysis: Apply a framework similar to the classification scheme used for E. coli genes, where multiple lines of evidence (experimental and computational) are weighted and integrated .

  • Condition dependency: Evaluate whether conflicting results stem from different experimental conditions, as YDL041W may have condition-specific functions.

  • Technical validation: Reproduce key experiments using multiple techniques (e.g., confirming localization using both fluorescence microscopy and subcellular fractionation).

  • Collaborative resolution: Establish collaborations between labs reporting conflicting results to standardize protocols and directly compare methodologies.

What are the optimal conditions for expressing and purifying recombinant YDL041W?

Based on available data, the following protocol has proven effective:

ParameterOptimal ConditionNotes
Expression SystemE. coliSuccessfully demonstrated for His-tagged construct
Expression VectorpET or similar with His-tagN-terminal His-tag fusion has been validated
Induction ConditionsIPTG concentration and temperature optimization requiredSpecific conditions not reported in available data
Purification MethodIMAC (Immobilized Metal Affinity Chromatography)Utilizing His-tag for purification
Buffer CompositionTris/PBS-based buffer, pH 8.0 with 6% TrehaloseAs reported for commercial preparations
Storage Conditions-20°C/-80°C with 5-50% glycerolAvoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation before opening recommended

For researchers establishing new purification protocols, it is advisable to:

  • Optimize expression conditions through small-scale expression trials

  • Include protease inhibitors during lysis

  • Validate protein identity through mass spectrometry

  • Assess protein purity through SDS-PAGE (>90% purity is achievable)

How can researchers effectively monitor YDL041W expression in engineered S. cerevisiae strains?

For monitoring YDL041W expression in engineered yeast strains, researchers can adapt methods used for other recombinant yeast proteins:

  • Molecular confirmation of gene integration:

    • PCR verification using gene-specific primers to confirm successful integration

    • Similar to methods used for ari1 gene verification in engineered S. cerevisiae

  • Protein expression verification:

    • Western blotting using anti-His antibodies for tagged constructs

    • Analogous to the approach used for confirming ari1 expression in engineered strains

  • Quantitative expression analysis:

    • Real-time PCR for mRNA levels, designing primers specific to YDL041W

    • Similar to methods used to monitor ari1 expression levels in response to different conditions

  • Growth and phenotypic monitoring:

    • Growth curve analysis to detect any impact of YDL041W overexpression

    • Measuring doubling time and lag phase under various conditions

    • Comparing wild-type and engineered strains, as performed for ari1-overexpressing strains

  • Stress response assessment:

    • Challenging strains with various stressors to identify condition-specific phenotypes

    • Similar to testing furfural and HMF tolerance in ari1-overexpressing strains

What analytical techniques are most informative for studying YDL041W structure-function relationships?

To investigate structure-function relationships of YDL041W, researchers should consider:

  • Structural analysis techniques:

    • Circular dichroism (CD) spectroscopy for secondary structure assessment

    • Nuclear magnetic resonance (NMR) for solution structure determination

    • X-ray crystallography for high-resolution structure (requires crystallization optimization)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

  • Functional domain mapping:

    • Truncation analysis to identify functional domains

    • Site-directed mutagenesis of conserved residues

    • Domain swapping with homologous proteins from related yeast species

  • Protein-protein interaction studies:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Cross-linking mass spectrometry for interaction interfaces

  • Computational structure-function analysis:

    • Molecular dynamics simulations to study conformational changes

    • Docking studies to predict potential ligand binding sites

    • Sequence-structure-function relationship analysis through evolutionary conservation mapping

  • Integrative structural biology approaches:

    • Combining low-resolution (SAXS, cryo-EM) with high-resolution techniques

    • Correlating structural features with functional assays

How can researchers effectively categorize YDL041W based on increasing functional evidence?

As research on YDL041W progresses, researchers can apply a systematic categorization framework similar to that used for E. coli genes:

Characterization LevelDefinitionEvidence Required for YDL041WCurrent Status
Well-characterizedBoth molecular function and biological process knownExperimental demonstration of biochemical activity and cellular roleNot reached
Partially characterizedEither function or process known, but not bothExperimental evidence for either molecular activity or involvement in a cellular pathwayNot reached
UncharacterizedVery little known about functionOnly sequence information availableCurrent classification

To advance YDL041W from "Uncharacterized" to "Partially characterized":

  • Obtain experimental evidence for either:

    • Specific molecular activity (e.g., enzymatic function, binding capability)

    • Involvement in a defined cellular process (e.g., stress response, membrane function)

  • Document evidence using standardized ontologies:

    • Gene Ontology (GO) terms for molecular function and biological process

    • Evidence codes distinguishing experimental from computational predictions

  • Apply computational analysis to support functional hypotheses:

    • Protein family classification

    • Domain identification

    • Structural prediction

What are the most promising research directions for elucidating YDL041W function?

Based on current knowledge and emerging methodologies, the following research directions hold promise:

  • High-throughput phenotypic screening:

    • Subjecting YDL041W deletion or overexpression strains to diverse growth conditions

    • Chemical genomics approaches to identify condition-specific requirements

    • Synthetic genetic array analysis to map genetic interactions

  • Multi-omics integration:

    • Correlating YDL041W expression with transcriptomic, proteomic, and metabolomic data

    • Identifying co-regulated genes and potential functional associations

    • Mapping YDL041W to cellular networks

  • Evolutionary and comparative genomics:

    • Analyzing YDL041W conservation across yeast species

    • Identifying co-evolving genes that might function in the same pathway

    • Reconstructing the evolutionary history of YDL041W

  • Cutting-edge structural biology:

    • Applying cryo-EM for membrane-associated structural studies

    • Using integrative modeling approaches to predict structure and interactions

    • Employing in-cell structural biology methods to study YDL041W in its native environment

  • CRISPR-based functional genomics:

    • Implementing CRISPR interference/activation to modulate YDL041W expression

    • Creating precise mutations to test structure-function hypotheses

    • Performing domain-specific functional screens

How can researchers contribute to community resources for uncharacterized proteins like YDL041W?

To advance collective knowledge about uncharacterized proteins:

  • Data deposition and sharing:

    • Submit experimental data to appropriate repositories (e.g., PDB, PRIDE, GenBank)

    • Share negative results to prevent duplication of unsuccessful approaches

    • Contribute to community annotation projects

  • Standardized reporting:

    • Use consistent nomenclature and identifiers (UniProt ID: Q12352 for YDL041W)

    • Report experimental conditions in detail to enable reproduction

    • Adopt standardized characterization levels (Well-characterized, Partially characterized, Uncharacterized)

  • Collaborative networks:

    • Form research consortia focused on uncharacterized proteins

    • Develop standardized experimental pipelines for functional characterization

    • Coordinate efforts to avoid duplication and maximize coverage

  • Resource development:

    • Create specialized databases for uncharacterized proteins

    • Develop prediction tools incorporating new data

    • Establish repositories for protocols and reagents

  • Integration with existing resources:

    • Link new findings to established databases like SGD (Saccharomyces Genome Database)

    • Update UniProt and other reference databases with new functional information

    • Contribute to ontology development for improved annotation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.