YDL172C is a recombinant protein derived from Saccharomyces cerevisiae (baker’s yeast), classified as a putative uncharacterized protein due to limited functional annotation. It is encoded by the YDL172C gene and has been expressed in E. coli for research purposes . While its precise biological role remains understudied, recent investigations suggest potential involvement in signaling pathways, particularly those regulated by the Target of Rapamycin Complex 1 (TORC1) .
| Parameter | Details |
|---|---|
| Gene Name | YDL172C |
| Synonyms | None reported |
| UniProt ID | Q12135 |
| Genomic Location | Chromosome IV |
| Open Reading Frame (ORF) | Overlaps with the C-terminal 155 codons of YDL173W (encoding Par32) |
| Protein Length | Full-length: 159 amino acids (1–159 aa) |
| Molecular Weight | Not explicitly reported |
| Isoelectric Point | Not explicitly reported |
| Sequence | MLFQLNIVFKELKNPDFFFFFFFFSLPLSSFKLNLSSSSSFKLWLIVFLLDFGEIMFPAP... |
Source: Saccharomyces Genome Database (SGD)
| Parameter | Details |
|---|---|
| Host Organism | E. coli |
| Tag | N-terminal His-tag |
| Purity | >90% (SDS-PAGE) |
| Storage Conditions | -20°C/-80°C (lyophilized powder) |
| Reconstitution | In deionized sterile water (0.1–1.0 mg/mL) |
| Buffer | Tris/PBS-based, 6% trehalose, pH 8.0 |
Recent studies implicate YDL172C in the TORC1 pathway, which regulates cellular growth and metabolism in response to nutrient availability . Key findings include:
Overlap with Par32: The YDL172C ORF overlaps with the C-terminal region of YDL173W, encoding Par32, a rapamycin-responsive protein .
Deletion Phenotypes:
Npr1 Dependency:
Polyclonal antibodies (e.g., Cusabio’s CSB-PA615465XA01SVG) enable detection of YDL172C in Western blot (WB) and ELISA .
Functional Annotation: Despite its overlap with Par32, YDL172C’s direct role in TORC1 signaling remains unclear. Further studies are needed to determine if it encodes a distinct protein or regulates YDL173W expression.
Structural Elucidation: High-resolution structural data could reveal functional motifs or interactions with TORC1 components.
Pathway Integration: Investigating YDL172C’s role in nutrient-sensing networks may provide insights into yeast stress responses and potential therapeutic targets.
STRING: 4932.YDL172C
YDL172C represents an open reading frame (ORF) in Saccharomyces cerevisiae that fully overlaps with the C-terminal 155 codons of YDL173W, which encodes the protein Par32 (phosphorylated after rapamycin) . This genomic arrangement creates a complex relationship between these two genes, as they exist on opposite DNA strands but share the same physical space in the genome . This arrangement makes experimental investigation particularly challenging, as genetic manipulations targeting YDL172C may inevitably affect PAR32/YDL173W expression. When analyzing phenotypes associated with deletion mutants, researchers should consider this overlap to accurately attribute observed effects to the correct gene product. Complementation studies using plasmids containing either gene can help distinguish their individual functions.
Current evidence suggests YDL172C is involved in the Target of Rapamycin Complex 1 (TORC1) signaling network, which regulates cell growth in response to nutrient availability. Deletion of YDL172C results in a severe defect in recovery from rapamycin-induced inhibition of TORC1 . Additionally, YDL172C has been identified as essential for growth under high-pressure conditions (35 MPa and 24°C), suggesting a role in stress response mechanisms . The protein has also been identified among genes required for nutrient uptake under high-pressure conditions, ranking within the top 24 genes for nutrient prototrophies that conferred growth . These associations provide important starting points for investigating the functional role of YDL172C in cellular metabolism and stress response pathways.
Distinguishing between YDL172C and PAR32/YDL173W functions requires a systematic approach due to their genomic overlap. An effective method involves creating targeted mutations that affect only one gene without disrupting the other, though this is challenging due to their overlapping nature. Researchers can employ site-directed mutagenesis to introduce silent mutations in one gene that don't alter the amino acid sequence of the overlapping gene. Additionally, utilizing plasmid-based complementation assays can help attribute specific phenotypes to each gene. For example, introducing a plasmid containing PAR32 and its regulatory sequences into Δpar32 cells fully rescued the defect in recovery from rapamycin . Similar complementation tests with YDL172C can help delineate its specific functions. RNA interference or antisense oligonucleotides may also be employed to selectively reduce expression of either gene to observe resulting phenotypes.
YDL172C appears to play a significant role in TORC1 signaling and recovery from rapamycin-induced inhibition. While the exact molecular mechanism remains unclear, deletion studies have demonstrated that cells lacking YDL172C exhibit severe defects in recovery from rapamycin treatment . This suggests YDL172C may function as either a positive regulator of TORC1 activity or in parallel pathways that become essential when TORC1 is inhibited. To investigate this role further, researchers should consider epistasis experiments with known TORC1 pathway components like GTR1, GTR2, and EGO1 . Measuring phosphorylation levels of downstream TORC1 targets such as S6K or 4E-BP1 in wild-type versus YDL172C deletion strains can provide insights into its regulatory function. Additionally, examining potential physical interactions between YDL172C and TORC1 components through co-immunoprecipitation or proximity labeling approaches may reveal direct associations within this important signaling network.
YDL172C has been identified as one of several genes required for growth under high-pressure conditions (35 MPa, 24°C) . Evidence suggests YDL172C is particularly important for nutrient uptake under high pressure, as deletion mutants show impaired growth that can be partially rescued by nutrient supplementation . To investigate this function, researchers should examine membrane integrity and nutrient transporter localization in YDL172C deletion strains under high-pressure conditions using fluorescence microscopy and biochemical fractionation techniques. Measuring uptake rates of labeled nutrients (amino acids, sugars) in wild-type versus deletion strains under normal and high-pressure conditions can quantify the transport defects. Transcriptomic and proteomic comparisons of wild-type and ΔYDL172C strains under pressure stress may reveal which specific transporters or membrane components are affected by its absence. Understanding this function has implications for both fundamental membrane biology and biotechnological applications requiring yeast growth under non-standard conditions.
Comprehensive protein-protein interaction studies are essential for understanding YDL172C function. Large-scale yeast two-hybrid screens have been employed to map protein interactions in Saccharomyces cerevisiae, though specific interactions involving YDL172C were not explicitly mentioned in the provided search results . To systematically identify YDL172C interaction partners, researchers should employ multiple complementary approaches: affinity purification coupled with mass spectrometry (AP-MS) using tagged YDL172C, proximity-dependent biotin identification (BioID), and targeted yeast two-hybrid assays with candidate interactors from related pathways. Analyzing these interaction networks within the context of known TORC1 signaling components and high-pressure response proteins may reveal functional clusters that place YDL172C in specific cellular processes. Validation of key interactions through co-immunoprecipitation, FRET, or split-protein complementation assays in vivo will strengthen these findings and may reveal condition-specific interactions that only occur under stress conditions or nutrient limitation.
Recombinant expression and purification of YDL172C require careful optimization due to its uncharacterized nature. An effective approach begins with codon-optimization for the expression system, whether in E. coli, insect cells, or homologous expression in S. cerevisiae. For bacterial expression, testing multiple tags (His6, GST, MBP) at both N- and C-termini can identify constructs with improved solubility. Expression conditions should be systematically optimized by varying temperature (16-30°C), induction strength, and duration. If bacterial expression yields insoluble protein, consider yeast or insect cell expression systems which provide eukaryotic post-translational modifications. For purification, a multi-step approach typically yields best results: initial capture via affinity chromatography (based on the fusion tag), followed by ion exchange chromatography and size exclusion chromatography to achieve high purity. Protein stability should be assessed through thermal shift assays to identify optimal buffer conditions. For particularly challenging constructs, consider expressing truncated domains or co-expression with binding partners identified through interaction studies.
Creating and validating YDL172C deletion or mutation strains presents unique challenges due to its genomic overlap with PAR32/YDL173W . When designing deletions, researchers must consider the potential impact on the overlapping gene. The CRISPR-Cas9 system offers precision for introducing specific mutations while minimizing disruption to PAR32. For complete deletions, the traditional homologous recombination approach with selectable markers remains effective, but researchers must verify effects on both genes. Validation requires a multi-faceted approach: PCR confirmation of the desired genetic changes, RT-qPCR to measure transcript levels of both YDL172C and PAR32, and western blotting (if antibodies are available) to confirm protein expression changes. Phenotypic validation should include testing growth under conditions where YDL172C is known to be important: recovery from rapamycin treatment and growth under high pressure (35 MPa, 24°C) . Complementation tests with plasmid-expressed wild-type or mutant versions of YDL172C can confirm that observed phenotypes result specifically from its absence rather than secondary effects.
Based on current knowledge of YDL172C's involvement in TORC1 signaling and high-pressure growth, several functional assays are particularly informative. For TORC1-related functions, researchers should measure recovery kinetics following rapamycin treatment by monitoring growth curves and the phosphorylation status of known TORC1 targets . The localization of TORC1 components under various nutrient conditions can be assessed through fluorescence microscopy in wild-type versus deletion strains. For high-pressure adaptation functions, growth assays under precisely controlled pressure conditions (using specialized equipment) should be performed, with and without nutrient supplementation to assess transporter functionality . Membrane integrity can be evaluated using fluorescent dyes like FM4-64 or propidium iodide. Nutrient uptake assays using radiolabeled or fluorescently labeled amino acids, sugars, and other nutrients will directly measure transport capabilities. Global approaches including transcriptomics, proteomics, and metabolomics comparing wild-type and deletion strains under normal and stress conditions can provide comprehensive insights into affected pathways and processes, generating hypotheses for more targeted investigations.
Resolving the functional relationship between these overlapping genes requires sophisticated genetic and biochemical approaches. One effective strategy is to create a series of single-nucleotide mutations that affect the amino acid sequence of one protein without altering the other, exploiting the degeneracy of the genetic code where possible. These precise mutations can then be analyzed for phenotypic effects to attribute functions to specific gene products. Another approach involves expressing each gene independently in heterologous systems where the overlapping gene is absent, allowing characterization of their individual functions. Researchers should also investigate potential functional relationships between the two proteins, as their genomic overlap may indicate evolutionary pressure for coordinated expression or function. Techniques such as synthetic genetic array (SGA) analysis with both single and double mutants can reveal genetic interactions that provide functional insights . Temporally controlled expression systems like the auxin-inducible degron (AID) system could allow rapid depletion of one protein to observe immediate effects before compensatory mechanisms develop.
Understanding YDL172C's structure and biochemical activities will require a multi-pronged approach. For structural characterization, recombinant protein expression and purification should be optimized for structural biology techniques including X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy. If full-length protein proves challenging, domain-based approaches focusing on predicted functional regions may prove successful. Computational approaches including AlphaFold2 can provide predicted structural models to guide experimental design. For biochemical activities, a systematic screening approach is recommended: testing for common enzymatic activities (kinase, phosphatase, protease, etc.), nucleic acid binding capabilities, and lipid interactions based on cellular localization data. High-throughput binding assays against metabolite libraries can identify potential ligands. Comparative sequence analysis with proteins of known function may reveal conserved motifs suggesting specific activities. Integration of structural information with interaction data can identify potential active sites or binding interfaces for further characterization through site-directed mutagenesis. Developing activity-based probes specific for predicted functions could enable in situ activity monitoring.
A comprehensive understanding of YDL172C function will emerge from integrating multiple experimental approaches and data types. Systems biology frameworks offer powerful methods for this integration. Researchers should combine: (1) genomic data regarding conservation, expression patterns, and genetic interactions; (2) proteomic data on interaction networks, post-translational modifications, and abundance under various conditions; (3) functional data from phenotypic screens under diverse stresses; and (4) structural information to predict molecular mechanisms. Network analysis can place YDL172C within the broader cellular signaling architecture, while temporal studies can reveal its dynamic behavior during stress responses or nutrient shifts. Machine learning approaches applied to these integrated datasets may reveal non-obvious functional relationships or predict conditions where YDL172C function becomes critical. Creating a searchable database of all experimental results related to YDL172C would facilitate this integration and accelerate discovery. Crucially, hypotheses generated through data integration should be experimentally validated, creating an iterative cycle of prediction and testing that progressively refines our understanding of this intriguing protein's cellular functions.
| Condition | Wild-type (OD600) | ΔYDL172C (OD600) | Ratio (mutant/WT) |
|---|---|---|---|
| Normal (0.1 MPa, 24°C) | 4.1 ± 0.1 | 1.1 ± 0.3 | 0.27 |
| High Pressure (35 MPa, 24°C) | 3.9 ± 0.3 | 0.8 ± 0.2 | 0.21 |
| Low Temperature (0.1 MPa, 6°C) | 3.5 ± 0.2 | 0.8 ± 0.2 | 0.23 |
This table demonstrates the significant growth defects observed in YDL172C deletion mutants across multiple conditions, particularly under high pressure and low temperature stress . The consistent reduction in growth across conditions suggests YDL172C plays a fundamental role in cellular processes beyond specific stress responses.
This comparison highlights the relationship between YDL172C and known TORC1 pathway components, suggesting it functions within or parallel to this signaling network . The similar phenotypic profiles under stress conditions and rapamycin treatment provide context for understanding YDL172C's position in cellular signaling networks.