Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDL196W (YDL196W)

Shipped with Ice Packs
In Stock

Description

Basic Characterization

YDL196W is encoded by the YDL196W gene in S. cerevisiae and is classified as a putative uncharacterized protein. Key attributes include:

  • Molecular Weight: 12,905 Da .

  • UniProt Accession: Q12187.1 .

  • Protein Family: Putative uncharacterized protein family .

  • Gene Location: Chromosome IV (Saccharomyces cerevisiae S288c) .

The protein is expressed recombinantly in E. coli systems for research use, with purification via antigen-affinity chromatography .

Key Parameters for Recombinant YDL196W

ParameterSpecificationSource
Host SystemE. coli
Purity≥90% (Antigen-affinity purified)
FormulationLiquid (50% glycerol, 0.01M PBS, pH7.4)
Storage-20°C or -80°C; avoid repeated freeze

Research Applications

YDL196W is primarily used in immunological and molecular studies:

  • Antibody Production: Rabbit polyclonal antibodies against YDL196W are available for ELISA and Western Blot applications .

  • Functional Studies: Located in the promoter region of SEC31, an essential gene involved in vesicle-mediated transport . This suggests a potential regulatory role, though experimental validation is pending.

Research Findings and Gaps

  • Tolerance Studies: While YDL196W itself is not directly linked to vaccine development, recombinant S. cerevisiae platforms (e.g., yeast-CEA) demonstrate antigen cross-presentation mechanisms that could inform future studies on uncharacterized proteins .

  • Biotechnological Potential: Engineered S. cerevisiae strains are used in bioethanol production and immunotherapy , but YDL196W’s role in these contexts remains unexplored.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have specific format requirements, please include them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
YDL196W; D1224; Putative uncharacterized protein YDL196W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDL196W
Target Protein Sequence
MPSESRKRLSSKKGATVRLELVENYVICFFTVLCFCLIPHSSIDWRSGLSCYYFIDFFFF HLSPSIPFWFYPFSVKNHHTRSIRPRTKSEKNKQVVSDPFLYSCSRVAF
Uniprot No.

Target Background

Database Links

STRING: 4932.YDL196W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YDL196W and why is it classified as a putative uncharacterized protein?

YDL196W is an open reading frame in the Saccharomyces cerevisiae genome encoding a protein whose function has not been fully elucidated through traditional biochemical or genetic characterization methods. The protein is classified as "putative uncharacterized" because while its sequence is known and it has been identified as a potential protein-coding gene, its precise biological function, structure, and role in cellular processes remain largely unknown . Notably, YDL196W exhibits highly variable expression in wild-type strains, as documented by Kemmeren et al. (2014), suggesting potential regulatory complexity or environmental responsiveness .

What expression patterns does YDL196W demonstrate in wild-type yeast strains?

YDL196W demonstrates highly variable expression levels across wild-type Saccharomyces cerevisiae strains, as reported by Kemmeren et al. (2014) . This variability suggests that YDL196W may be subject to complex regulatory mechanisms that respond to subtle differences in genetic background, environmental conditions, or metabolic states. Researchers investigating this protein should account for this inherent expression variability when designing experiments by including appropriate biological replicates and controls. Examination of expression data across different growth conditions and genetic backgrounds can provide insights into potential regulatory mechanisms and functional contexts.

What phenotypic effects result from YDL196W deletion in S. cerevisiae?

Deletion of YDL196W in Saccharomyces cerevisiae BY4742 (creating a YDL196W-delta strain) results in abolished vegetative cell population viability when grown in YPD medium, as documented in phenotype annotation OMP_AN:25566 . This suggests that despite being uncharacterized, YDL196W plays an essential role in maintaining cell viability under standard laboratory growth conditions. The specific molecular mechanisms by which YDL196W contributes to cell viability remain to be elucidated, but this phenotypic outcome provides strong evidence for its biological significance and creates a foundation for further functional characterization studies.

How can researchers effectively characterize the molecular function of YDL196W?

Characterizing the molecular function of YDL196W requires a multi-faceted approach combining genetic, biochemical, and computational methods:

  • Comparative Genomics Analysis: Identify potential homologs across species to infer possible functions based on evolutionary conservation patterns.

  • Protein-Protein Interaction Studies: Employ techniques such as yeast two-hybrid, co-immunoprecipitation followed by mass spectrometry, or proximity labeling approaches to identify interaction partners that may suggest functional pathways.

  • Transcriptomic Analysis: Analyze gene expression changes in YDL196W deletion or overexpression strains under various conditions to identify co-regulated genes and potential functional relationships.

  • Subcellular Localization: Determine the cellular compartment where YDL196W functions using fluorescent protein tagging or immunolocalization techniques.

  • Domain Analysis and Structural Prediction: Identify potential functional domains through computational analysis and validate through targeted mutagenesis.

For recombinant expression, researchers have multiple options including E. coli, yeast, mammalian, and insect cell systems, with various fusion tags available to facilitate purification and functional studies .

What experimental approaches are most effective for studying the role of YDL196W in stress response pathways?

Given the evidence suggesting YDL196W's importance for cell viability and its variable expression in wild-type strains , investigating its potential role in stress response pathways requires systematic experimental designs:

  • Stress-Specific Expression Profiling: Measure YDL196W expression levels under various stress conditions (oxidative, heat, osmotic, nutrient limitation) using RT-qPCR or RNA-seq approaches.

  • Synthetic Genetic Array Analysis: Screen for genetic interactions between YDL196W and known stress response genes to map potential pathway connections.

  • Promoter Analysis: Examine YDL196W promoter architecture for stress-responsive elements similar to those found in engineered stress-responsive yeast promoters .

  • Conditional Depletion Studies: Employ an anchor-away or degron system to rapidly deplete YDL196W protein levels and observe immediate cellular responses under different stress conditions.

  • Metabolomic Analysis: Compare metabolite profiles between wild-type and YDL196W mutant strains under stress conditions to identify affected metabolic pathways.

These approaches would help determine whether YDL196W functions directly in stress response pathways or if its role in maintaining cell viability is independent of specific stress responses.

What is known about the transcriptional regulation of YDL196W and how might it relate to its function?

Current research indicates that YDL196W has highly variable expression in wild-type strains , suggesting complex transcriptional regulation. While specific transcription factors controlling YDL196W expression are not directly mentioned in the available search results, several approaches can help elucidate its regulation:

  • Promoter Sequence Analysis: Examining the YDL196W promoter for known transcription factor binding sites can provide insights into potential regulatory mechanisms.

  • ChIP-seq Studies: Identifying transcription factors that bind to the YDL196W promoter region under different conditions.

  • TFIID Dependency Analysis: Since research has identified distinct mechanisms that distinguish TFIID housekeeping from regulatable promoters , determining whether YDL196W depends on canonical TFIID or alternative transcription initiation complexes could provide insights into its regulatory category.

  • Time-Course Expression Analysis: Monitoring YDL196W expression during cell cycle progression or in response to environmental changes.

Understanding YDL196W's transcriptional regulation could help explain its variable expression patterns and provide clues to its biological function and importance in specific cellular contexts.

What expression systems are most suitable for producing recombinant YDL196W protein?

Multiple expression systems are available for producing recombinant YDL196W protein, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coli- Rapid growth
- Simple culture conditions
- High protein yields
- Cost-effective
- May lack proper eukaryotic post-translational modifications
- Potential folding issues for eukaryotic proteins
10-100 mg/L culture
Yeast (S. cerevisiae, P. pastoris)- Native environment for YDL196W
- Proper eukaryotic folding
- Post-translational modifications
- Lower yields than E. coli
- Longer expression time
5-50 mg/L culture
Insect cells- Advanced eukaryotic folding machinery
- Complex post-translational modifications
- Higher cost
- Technical complexity
- Longer production timeline
1-10 mg/L culture
Mammalian cells- Most sophisticated folding and modification systems- Highest cost
- Most technically demanding
- Longest production timeline
0.5-5 mg/L culture

The choice should be guided by research objectives. For structural studies requiring large amounts of protein, E. coli may be preferred if the protein folds correctly. For functional studies where post-translational modifications may be critical, yeast or higher eukaryotic systems would be more appropriate . Available fusion tag options include His, FLAG, MBP, GST, trxA, Nus, Biotin, and GFP tags, which can be positioned at either the N or C terminus to facilitate purification and detection .

What purification strategies are most effective for YDL196W, and how can protein quality be assessed?

Effective purification of YDL196W depends on the expression system and fusion tags employed. A comprehensive purification strategy might include:

  • Affinity Chromatography: The primary purification step leveraging fusion tags:

    • His-tagged proteins: Ni-NTA or IMAC chromatography

    • GST-tagged proteins: Glutathione sepharose

    • MBP-tagged proteins: Amylose resin

  • Secondary Purification:

    • Ion exchange chromatography based on YDL196W's predicted isoelectric point

    • Size exclusion chromatography to remove aggregates and achieve higher purity

  • Quality Assessment Methods:

    • SDS-PAGE with Coomassie or silver staining to assess purity and integrity

    • Western blotting to confirm identity

    • Dynamic light scattering to evaluate homogeneity and detect aggregation

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assay to evaluate stability

  • Functional Assessment:

    • Activity assays based on predicted or known functions

    • Binding assays with potential interaction partners

For optimal results, protein reprocessing options including renaturation, endotoxin removal, filtration sterilization, and lyophilization are available . The purification strategy should be optimized based on the specific downstream applications, whether structural studies, functional assays, or antibody production.

How can researchers design experiments to identify potential interaction partners of YDL196W?

Identifying interaction partners is critical for understanding YDL196W's functional context. Several complementary approaches can be employed:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged YDL196W in yeast cells

    • Perform affinity purification under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions with reciprocal pull-downs or co-immunoprecipitation

  • Yeast Two-Hybrid Screening:

    • Use YDL196W as bait against a yeast genomic library

    • Screen for positive interactions based on reporter gene activation

    • Confirm interactions with secondary assays

  • Proximity-Based Labeling:

    • Create fusion proteins with BioID or APEX2 enzymes

    • Allow in vivo labeling of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Genetic Interaction Mapping:

    • Perform synthetic genetic array analysis with YDL196W deletion

    • Identify genes with synthetic lethal or synthetic sick interactions

    • These often indicate parallel pathways or complex membership

  • Co-expression Network Analysis:

    • Analyze transcriptomic datasets to identify genes co-expressed with YDL196W

    • These may represent functionally related proteins

The choice of method depends on research objectives and available resources, with AP-MS and yeast two-hybrid being the most established approaches for initial interaction discovery.

What strategies can effectively elucidate the impact of YDL196W on genome-wide transcription patterns?

Given the observation that YDL196W deletion affects cell viability , understanding its impact on transcription patterns could provide insights into its cellular function. Effective strategies include:

  • RNA-seq Analysis:

    • Compare transcriptomes of wild-type and YDL196W conditional mutants

    • Use temperature-sensitive alleles or regulated promoters to bypass viability issues

    • Perform time-course experiments during YDL196W depletion

    • Analyze under various stress conditions to identify condition-specific effects

  • Nascent Transcription Analysis:

    • Employ metabolic labeling techniques (4sU-seq, NET-seq)

    • Distinguish direct transcriptional effects from secondary consequences

  • ChIP-seq Analysis:

    • If YDL196W potentially affects chromatin or transcription, perform ChIP-seq

    • Map genome-wide binding patterns of YDL196W

    • Correlate binding with transcriptional changes

  • Promoter-Reporter Assays:

    • Test effects on specific promoters using reporter genes

    • Focus on promoters showing significant expression changes in genome-wide studies

A combination of these approaches would provide complementary data on how YDL196W influences transcription, potentially revealing its role in specific biological processes.

What technical considerations are important when analyzing phenotypic effects of YDL196W mutations compared to complete gene deletion?

The analysis of YDL196W mutations versus complete deletion requires careful experimental design to avoid misinterpretation:

  • Mutation Strategy Selection:

    • Point mutations in predicted functional domains

    • Truncation mutations at different positions

    • Domain swaps to test functional conservation

  • Expression Level Considerations:

    • Ensure mutant proteins are expressed at levels comparable to wild-type

    • Use Western blotting to confirm expression and stability

    • Consider using endogenous promoter rather than overexpression

  • Strain Background Effects:

    • The phenotypic impact may vary across strain backgrounds

    • Test mutations in multiple strain backgrounds

    • Include proper isogenic controls

  • Conditional Alleles:

    • For essential functions, use temperature-sensitive or auxin-inducible degron alleles

    • Allow controlled depletion to study immediate effects

  • Complementation Testing:

    • Verify that wild-type YDL196W complements deletion phenotypes

    • Test whether mutants complement deletion to varying degrees

  • Phenotypic Assay Selection:

    • Use quantitative assays beyond simple growth/no growth

    • Measure growth rates, metabolic activities, stress responses

    • Consider microscopy for morphological phenotypes

  • Distinguishing Hypomorphic vs. Neomorphic Effects:

    • Determine whether mutations cause loss of function or gain of novel functions

    • Compare heterozygous diploids to identify dominant negative effects

These considerations will help researchers distinguish between complete loss-of-function effects and partial or altered function effects, providing more nuanced insights into YDL196W's biological roles.

What structural analysis methods are most appropriate for characterizing YDL196W?

Determining the structure of YDL196W requires selecting appropriate methods based on the protein's properties and research objectives:

MethodAdvantagesLimitationsRequired Sample AmountResolution
X-ray Crystallography- Highest resolution
- Complete structural details
- Can resolve bound cofactors
- Requires protein crystals
- Challenging for flexible proteins
5-10 mg of pure protein1-3 Å
Cryo-electron Microscopy- No crystallization needed
- Works with larger complexes
- Can capture multiple conformations
- Lower resolution for small proteins
- Expensive equipment
0.1-1 mg of pure protein2-4 Å
NMR Spectroscopy- Solution state structure
- Dynamic information
- Interaction mapping
- Size limitation (~30-40 kDa)
- Requires isotope labeling
5-20 mg of labeled protein2-5 Å
Small-angle X-ray Scattering- Low sample requirements
- Works in solution
- No size limitations
- Low resolution
- Shape information only
0.1-1 mg of pure protein10-30 Å

Based on the expected molecular weight and properties of YDL196W, a combination of methods might provide the most comprehensive structural insights. Initial bioinformatic analysis for domain prediction and disorder estimation should guide method selection. If molecular weight permits, NMR would provide valuable dynamic information, while X-ray crystallography would offer the highest resolution structural details if crystals can be obtained.

How can researchers effectively analyze post-translational modifications of YDL196W?

Comprehensive analysis of YDL196W post-translational modifications (PTMs) requires multiple complementary approaches:

  • Mass Spectrometry-Based Identification:

    • Bottom-up proteomics with enrichment strategies for specific PTM types:

      • Phosphorylation: TiO₂ or IMAC enrichment

      • Glycosylation: Lectin affinity or hydrazide chemistry

      • Ubiquitination: Antibody-based enrichment of diGly remnants

    • Top-down proteomics for intact protein analysis to preserve modification stoichiometry

    • Targeted approaches using parallel reaction monitoring for quantification

  • Site-Specific Mutation Analysis:

    • Mutate predicted modification sites to non-modifiable residues

    • Assess functional consequences in vivo

    • Compare phenotypes to YDL196W deletion

  • Modification-Specific Detection Methods:

    • Western blotting with modification-specific antibodies (phospho, acetyl, etc.)

    • ProQ Diamond staining for phosphorylations

    • Glycan-specific staining methods

  • Dynamic Analysis:

    • Monitor modification changes under different conditions

    • Time-course analysis during cell cycle or stress responses

    • Correlation with functional changes

  • Structural Integration:

    • Map identified PTMs onto structural models

    • Assess potential impact on protein function

    • Molecular dynamics simulations to predict effects on protein dynamics

This multi-faceted approach would provide a comprehensive view of YDL196W's modification landscape and how it contributes to protein function and regulation.

What are the most promising future research directions for understanding YDL196W function?

Based on current knowledge about YDL196W, several promising research directions emerge:

  • Systems Biology Integration:

    • Combine proteomics, transcriptomics, and metabolomics data to place YDL196W in broader cellular networks

    • Use multi-omics approaches to identify condition-specific roles

  • Evolutionary Function Prediction:

    • Perform deep phylogenetic analysis across fungal species

    • Identify conserved domains and sequences that might indicate function

    • Study homologs in related species where function might be better characterized

  • Synthetic Biology Applications:

    • Explore the potential of YDL196W's highly variable expression for designing synthetic regulatory circuits

    • Investigate applications of engineered YDL196W variants in biotechnology

  • Structure-Guided Drug Discovery:

    • If YDL196W proves essential for fungal viability, explore it as an antifungal target

    • Use structural information to design inhibitors

  • Technological Development:

    • Apply emerging technologies like CRISPR interference or CRISPR activation for fine-tuned manipulation of YDL196W expression

    • Develop better tools for studying essential genes in yeast

These directions would build upon existing knowledge of YDL196W's importance for cell viability and its variable expression patterns , potentially revealing novel biological mechanisms and applications.

How can contradictory experimental results regarding YDL196W function be reconciled and addressed?

When faced with contradictory results in YDL196W research, systematic approaches can help resolve discrepancies:

  • Strain Background Differences:

    • Given YDL196W's known variable expression across wild-type strains , carefully document and compare genetic backgrounds

    • Re-test key findings in multiple strain backgrounds

  • Experimental Condition Standardization:

    • Establish standard growth conditions and protocols

    • Document detailed experimental parameters for reproducibility

    • Test how slight variations in conditions affect outcomes

  • Genetic Compensation Mechanisms:

    • Investigate potential suppressor mutations that may arise in YDL196W mutants

    • Use acute depletion methods rather than sustained gene deletion to minimize adaptation

  • Technical Approach Comparison:

    • Directly compare different methodologies in parallel experiments

    • Assess whether discrepancies arise from technical limitations

  • Functional Redundancy Analysis:

    • Identify potential paralogs or functionally redundant proteins

    • Test double or triple mutants to overcome redundancy

    • Analyze condition-specific roles that might explain contradictory results

  • Community Resources Development:

    • Establish a centralized database of YDL196W findings

    • Promote pre-registration of experiments and sharing of negative results

By systematically addressing sources of variation and contradiction, researchers can develop a more coherent understanding of YDL196W's function and establish a foundation for future studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.