Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR029W (YDR029W)

Shipped with Ice Packs
In Stock

Description

Functional Insights

While YDR029W remains largely uncharacterized, experimental data suggest:

  • Subcellular Localization: GFP-fusion proteins localize to the endoplasmic reticulum, implicating potential roles in secretory pathways .

  • Telomere Interaction: Homodimer formation via its N-terminus and possible involvement in telomere capping, though direct mechanistic evidence is lacking .

  • Non-Essentiality: Gene deletion studies indicate YDR029W is not critical for viability under standard laboratory conditions .

Research Applications

The recombinant protein is commercially available for biochemical studies, with suppliers including:

SupplierProduct Highlights
Creative BioMart Full-length protein (1-104 aa), lyophilized, His-tagged, expressed in E. coli
CUSABIO Catalog number CB515636581, offered for bulk research applications
CBM15 ELISA-compatible format, supplied in Tris-based buffer with 50% glycerol

Sequence and Homology

YDR029W is conserved across S. cerevisiae strains but lacks homologs in higher eukaryotes. Its sequence includes a hydrophobic region (residues 20-80), suggesting membrane association .

Research Limitations and Future Directions

Current knowledge gaps include:

  • No confirmed enzymatic or binding activities .

  • Limited data on interacting partners or pathways .

  • Absence of structural studies (e.g., X-ray crystallography or NMR) .

Further studies could prioritize functional assays, interaction screens, and structural analyses to elucidate its role in yeast biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please communicate this to us, and we will prioritize developing the product with your requested tag.
Synonyms
YDR029W; Uncharacterized protein YDR029W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR029W
Target Protein Sequence
MSKYYILIELMNDKKNTNSSCDIFSFYLNFSDNPFSSFRLKSRLLYGIFSCFLLFYSLKD LIGVFKQKYLYLSILLLWLLVLLFCLAKGLSHNLRADSFLQYPL
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR029W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of YDR029W in Saccharomyces cerevisiae?

YDR029W is a gene located on chromosome IV in the S. cerevisiae genome. It encodes a putative uncharacterized protein with limited functional annotation in current databases. The gene is part of the reference genome sequence derived from laboratory strain S288C, which serves as the standard for yeast genomic studies . To study its genomic context, researchers should utilize the Saccharomyces Genome Database (SGD), which provides comprehensive information including the gene's coordinates, neighboring genes, and potential regulatory elements. For initial characterization, performing sequence alignments using BLASTN or BLASTP against fungal databases can provide insights into evolutionary conservation and potential functional domains .

What are the basic structural properties of the YDR029W protein?

The YDR029W protein's basic properties can be obtained from the Saccharomyces Genome Database, which provides sequence-derived information such as length, molecular weight, and isoelectric point. Additionally, experimentally determined data including median abundance and median absolute deviation are available . For detailed structural analysis, researchers should:

  • Generate in silico protein structure predictions using tools like AlphaFold

  • Validate predictions with experimental approaches such as X-ray crystallography or NMR spectroscopy

  • Analyze potential functional domains using sequence analysis tools

Similar to other uncharacterized proteins, structure prediction confidence should be evaluated using pLDDT (predicted Local Distance Difference Test) scores, which range from 0-100 with higher scores indicating higher confidence .

How does the expression profile of YDR029W vary under different conditions?

YDR029W expression patterns can vary significantly depending on growth conditions. To comprehensively study expression profiles, researchers should:

  • Analyze transcriptomics data from various growth conditions (carbon sources, oxygen levels)

  • Compare expression levels in different growth phases

  • Examine regulation in response to stress conditions

Based on research with similar yeast genes, expression profiles often show significant variation depending on carbon source availability. For instance, when S. cerevisiae is grown on different carbon sources such as glucose versus xylose, substantial changes in mRNA transcript levels for various metabolic pathways are observed . YDR029W may exhibit similar regulatory patterns dependent on carbon source, with potential links to respiratory or fermentative metabolism.

What are the most effective methods for creating YDR029W knockout strains?

Creating effective YDR029W knockout strains requires precise genetic manipulation techniques. The recommended methodological approach includes:

  • CRISPR-Cas9 System: Design guide RNAs targeting YDR029W with minimal off-target effects.

  • Homologous Recombination: Use selection markers (URA3, TRP1, LEU2) flanked by homology regions.

  • Verification Strategy: Confirm knockouts using both PCR and phenotypic analysis.

The process should incorporate strain background considerations, as genetic manipulations in S. cerevisiae are influenced by strain characteristics. Laboratory strains like S288C or EBY100 [MATa AGA1::GAL1-AGA1::URA3 ura3–52 trp1 leu2-delta200 his3-delta200 pep4::HIS3] provide well-characterized backgrounds for such studies . For comprehensive phenotypic analysis, researchers should document all observable phenotypes using standardized terminology similar to GO annotations, specifying the qualifier (e.g., "abnormal"), mutant type, strain background, and experimental conditions .

How can researchers effectively overexpress and purify the YDR029W protein?

For effective overexpression and purification of YDR029W protein:

  • Expression System Selection: For functional studies, homologous expression in S. cerevisiae using GAL1 promoter-driven vectors provides native post-translational modifications. For high yield purification, heterologous expression in E. coli may be preferable.

  • Purification Strategy: Implement a multi-step purification protocol:

Purification StepMethodBuffer CompositionExpected Yield
Initial CaptureAffinity Chromatography (His-tag)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole70-80%
IntermediateIon Exchange Chromatography20 mM Tris-HCl pH 7.5, 50-500 mM NaCl gradient50-60%
Final PolishingSize Exclusion Chromatography20 mM Tris-HCl pH 7.5, 150 mM NaCl30-40%
  • Verification: Assess protein purity by SDS-PAGE and confirm identity through mass spectrometry and Western blotting .

When designing expression constructs, researchers should consider codon optimization if using heterologous systems, and incorporate protease cleavage sites for tag removal if native protein function is required for downstream analysis.

What approaches are most effective for studying YDR029W interactions with other proteins?

To effectively study YDR029W protein interactions:

  • Yeast Two-Hybrid (Y2H) Screening: Construct bait plasmids containing YDR029W fused to a DNA-binding domain and screen against a prey library of S. cerevisiae proteins fused to an activation domain.

  • Co-Immunoprecipitation (Co-IP): Express tagged YDR029W in yeast cells, lyse under non-denaturing conditions, and capture protein complexes using antibodies against the tag.

  • Proximity-Based Labeling: Employ BioID or APEX2 fusions with YDR029W to biotinylate proximal proteins in vivo.

  • Crosslinking Mass Spectrometry (XL-MS): Use chemical crosslinkers to stabilize transient interactions followed by mass spectrometry analysis.

When interpreting results, researchers should cross-validate findings using multiple approaches, as each method has distinct biases. For instance, Y2H may detect direct binary interactions but miss those requiring post-translational modifications, while Co-IP can identify complexes but may not distinguish direct from indirect interactions .

How does YDR029W contribute to cellular metabolism in recombinant S. cerevisiae?

The contribution of YDR029W to cellular metabolism requires systematic investigation through both deletion and overexpression studies. While direct information about YDR029W's metabolic role is limited in the provided search results, analysis of similar uncharacterized proteins in S. cerevisiae suggests potential involvement in:

  • Carbon Source Utilization: Growth studies comparing wild-type and YDR029W mutant strains on different carbon sources (glucose, xylose, glycerol) can reveal metabolic functions.

  • Respiratory vs. Fermentative Metabolism: Based on studies of recombinant S. cerevisiae engineered for xylose metabolism, the expression of respiratory genes can be significantly altered when cells grow on different carbon sources . YDR029W may play a role in this metabolic switching.

  • Redox Balance Regulation: Cytosolic redox imbalance in recombinant S. cerevisiae influences respiratory protein expression . Researchers should investigate whether YDR029W is involved in maintaining redox homeostasis by measuring NAD+/NADH ratios in deletion strains.

For comprehensive metabolic analysis, researchers should employ both targeted metabolomics focusing on key metabolites and 13C-flux analysis to quantify changes in central carbon metabolism when YDR029W is deleted or overexpressed.

How can YDR029W be engineered for improved metabolic capabilities in S. cerevisiae?

Engineering YDR029W for enhanced metabolic capabilities requires a systematic approach:

  • Protein Engineering Strategies:

    • Directed evolution to select for improved variants

    • Rational design based on structural predictions

    • Domain swapping with functionally characterized homologs

  • Integration with Metabolic Engineering:

    • Co-expression with complementary metabolic genes

    • Optimization of expression levels through promoter engineering

    • Chassis strain optimization to support desired metabolic flux

When engineering recombinant S. cerevisiae strains, consider that they may not recognize certain substrates (like xylose) as fermentable carbon sources, resulting in unexpected gene expression patterns . This phenomenon has been observed in engineered strains where genes for the tricarboxylic acid cycle and respiratory enzymes showed increased expression when grown on xylose compared to glucose .

What role might YDR029W play in stress response mechanisms?

The potential role of YDR029W in stress response mechanisms can be investigated through:

  • Stress Challenge Experiments: Expose wild-type and YDR029W deletion strains to various stressors (oxidative, osmotic, temperature) and quantify survival rates.

  • Transcriptional Response: Analyze changes in YDR029W expression under different stress conditions using RT-PCR or RNA-seq.

  • Protein Localization: Track GFP-tagged YDR029W localization during stress response using fluorescence microscopy.

Research on recombinant S. cerevisiae has shown that certain genes are differentially regulated under oxygen limitation conditions . For example, expression of genes encoding tricarboxylic acid cycle and respiratory enzymes (HXK1, ADH2, COX13, NDI1, and NDE1) increased significantly when cells were cultivated on xylose, and were even more elevated under oxygen limitation . Similar experimental approaches should be applied to YDR029W to determine its potential role in oxygen limitation response or other stress conditions.

How should researchers analyze and interpret YDR029W gene expression data?

For robust analysis of YDR029W expression data:

  • RNA-Seq Analysis Workflow:

    • Quality control and preprocessing of raw reads

    • Alignment to S. cerevisiae reference genome

    • Normalization of count data (RPKM, TPM, or DESeq2 normalization)

    • Differential expression analysis with appropriate statistical methods

  • Data Presentation Format:

    ConditionReplicate 1 (FPKM)Replicate 2 (FPKM)Replicate 3 (FPKM)Average (FPKM)Log2 Fold Changep-value
    GlucosevaluevaluevaluevaluereferenceN/A
    Xylosevaluevaluevaluevaluevaluevalue
    Ethanolvaluevaluevaluevaluevaluevalue
  • Contextual Interpretation: Compare YDR029W expression patterns with known regulons and stress response pathways. For example, genes regulated by the HAP4 transcription factor, which is involved in respiratory gene expression, show significant increases during xylose metabolism under oxygen-limited conditions . Determining whether YDR029W follows similar patterns can provide functional insights.

When analyzing gene expression data, researchers should employ both GeneChip studies and RT-PCR validation to ensure reliability, as these methods have been shown to provide concordant results in yeast gene expression studies .

What computational approaches are recommended for predicting YDR029W function?

For computational prediction of YDR029W function:

  • Sequence-Based Approaches:

    • Homology detection using PSI-BLAST and HHpred

    • Motif and domain identification using InterProScan

    • Conservation analysis across fungal species

  • Structure-Based Methods:

    • AlphaFold2 or similar tools for protein structure prediction

    • Structure-based function annotation using tools like ProFunc or COACH

    • Molecular docking to predict potential ligands

  • Network-Based Analysis:

    • Integration of protein-protein interaction data

    • Co-expression network analysis

    • Metabolic network context analysis

  • Machine Learning Applications:

    • Artificial Neural Network methods for function prediction, similar to those used for predicting protein-coding regions in DNA sequences

    • Feature extraction from multiple data types (sequence, structure, expression)

These computational predictions should be assessed using confidence metrics similar to those used for structure models (e.g., pLDDT scores) and validated experimentally. As with any uncharacterized protein, computational predictions should be treated as hypotheses to guide experimental design rather than definitive functional assignments.

How can researchers effectively interpret phenotypic data from YDR029W mutant strains?

For effective interpretation of YDR029W mutant phenotypes:

  • Systematic Phenotyping Approach:

    • Growth rate analysis in multiple media compositions

    • Microscopic assessment of cellular morphology

    • Metabolite profiling using LC-MS or GC-MS

    • Functional assays targeting predicted processes

  • Data Integration Framework:

    • Correlate phenotypic changes with transcriptomic alterations

    • Compare with phenotypes of functionally related genes

    • Position findings within known metabolic and regulatory networks

  • Standardized Reporting:

    • Use GO Annotation style for phenotype documentation

    • Include observable phenotype, qualifier, mutant type, strain background, and reference

    • Classify observations as deriving from classical genetics or high-throughput approaches

When analyzing phenotypes, researchers should distinguish between direct effects of YDR029W mutation and compensatory responses. For example, recombinant S. cerevisiae with altered metabolic pathways can show unexpected changes in expression of respiratory genes due to redox imbalance or changes in growth rate , which might complicate interpretation of specific gene functions.

What are the most promising applications for engineered YDR029W variants in biotechnology?

  • Metabolic Engineering Applications:

    • If YDR029W is involved in carbon source utilization, engineered variants might enhance fermentation of non-conventional sugars

    • Potential role in improving stress tolerance for industrial fermentation processes

    • Possible application in bioethanol production if involved in respiratory/fermentative balance

  • Synthetic Biology Integration:

    • Development as a regulatory component in synthetic gene circuits

    • Potential as a biosensor element if responsive to specific metabolites or conditions

    • Integration into minimal or designer yeast genomes

Future research should focus on thorough functional characterization before application development, following similar experimental approaches used for other initially uncharacterized yeast proteins that were later found to have significant biotechnological value.

How can systems biology approaches advance our understanding of YDR029W?

Systems biology approaches for YDR029W research should include:

  • Multi-omics Integration:

    • Combine transcriptomic, proteomic, metabolomic, and phenomic data

    • Develop computational models integrating multiple data types

    • Apply network analysis to position YDR029W within cellular systems

  • Genome-Scale Modeling:

    • Incorporate YDR029W into genome-scale metabolic models of S. cerevisiae

    • Perform flux balance analysis to predict metabolic impacts of YDR029W manipulation

    • Validate model predictions experimentally

  • Synthetic Genetic Interaction Mapping:

    • Perform systematic genetic interaction screens with YDR029W deletion

    • Construct and analyze double mutant libraries

    • Apply computational approaches to interpret genetic interaction networks

These approaches should be designed to overcome the challenges of studying uncharacterized proteins, where function cannot be inferred from sequence alone. By generating diverse, complementary datasets and integrating them computationally, researchers can develop testable hypotheses about YDR029W function and its position within broader cellular systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.