Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR215C (YDR215C)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR215C (YDR215C) is a protein derived from the yeast Saccharomyces cerevisiae, also known as budding yeast, which is extensively used in basic research on eukaryotic organisms . YDR215C is a protein that, as the name suggests, has not yet been fully characterized .

Table 1: General Information of YDR215C

FeatureDescription
OrganismSaccharomyces cerevisiae
Protein NamePutative uncharacterized protein YDR215C
SynonymsYDR215C; YD8142.15c; YD8142B.07c; Uncharacterized protein YDR215C
UniProt IDQ12240

Recombinant Production

Recombinant YDR215C is produced using genetic engineering techniques, where the gene encoding YDR215C is inserted into a host organism (e.g., E. coli) to express and produce the protein . The recombinant protein often includes a tag, such as a His-tag, to facilitate purification .

Table 2: Recombinant Protein Details

FeatureDescription
SourceE. coli
TagN-terminal His tag
Protein LengthFull Length (1-127 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL, add 5-50% glycerol for storage
Amino Acid SequenceMKTPPNQEKNNEKISLLFSSQRLTIDVHPSSVYHIVLSSNNADRHQVTLSFTARSRMMPLTRARLSAIILACSACSLTPWSSLPSPPAFPFPLSCQGAVHTTQAHPAPKNRGKTTALWFRSFPPMAL

Function and Role in Saccharomyces cerevisiae

As an uncharacterized protein, the precise function of YDR215C in Saccharomyces cerevisiae is not yet known . Many proteins in yeast remain uncharacterized, and research is ongoing to determine their functions through various methods such as genetic analysis, protein-protein interaction studies, and biochemical assays .

Protein Interactions and Complex Formation

Studies on Saccharomyces cerevisiae have identified numerous protein complexes, but there is no specific data linking YDR215C to any known complexes . Large-scale studies have cataloged many heteromeric protein complexes, providing a valuable resource for discovering protein interactions, but YDR215C is not currently listed in these catalogs .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, special format requests should be specified during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
YDR215C; YD8142.15c; YD8142B.07c; Uncharacterized protein YDR215C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR215C
Target Protein Sequence
MKTPPNQEKNNEKISLLFSSQRLTIDVHPSSVYHIVLSSNNADRHQVTLSFTARSRMMPL TRARLSAIILACSACSLTPWSSLPSPPAFPFPLSCQGAVHTTQAHPAPKNRGKTTALWFR SFPPMAL
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR215C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YDR215C and why is it classified as a putative uncharacterized protein?

YDR215C is an open reading frame (ORF) located on chromosome IV of Saccharomyces cerevisiae that encodes a protein whose function has not been fully characterized through experimental validation. It is classified as "putative uncharacterized" because bioinformatic analysis suggests it encodes a protein, but its biological role, biochemical function, and cellular importance remain largely unknown .

The methodological approach to studying such proteins typically begins with sequence analysis using tools like BLAST to identify potential homologs, followed by domain prediction software to identify conserved motifs that might suggest function. Researchers should conduct both nucleotide and protein BLAST searches against fungal genomes to identify potential orthologs that might have better characterization .

What are the most effective initial approaches for studying an uncharacterized protein like YDR215C?

When beginning research on an uncharacterized protein like YDR215C, a systematic approach is recommended:

  • Sequence analysis and annotation verification: Confirm the gene structure using RNA-Seq data and proteomics data to verify translation start site, splicing junctions, and protein length.

  • Localization studies: Generate fluorescent protein fusions (GFP/RFP) to determine subcellular localization under various growth conditions.

  • Expression profiling: Measure transcript and protein abundance across different growth phases, stress conditions, and carbon sources using qPCR and Western blotting.

  • Phenotypic screening: Create deletion mutants and assess growth under various conditions to identify potential functions.

  • Structural predictions: Use tools like AlphaFold or I-TASSER to predict protein structure for functional insights.

This multi-faceted approach provides complementary data streams that can converge to suggest potential functions. The experimental design should include appropriate controls and standardized conditions to ensure reproducibility and reliability of results .

What genomic and sequence features of YDR215C should researchers be aware of before designing experiments?

Before designing experiments involving YDR215C, researchers should familiarize themselves with several key features:

Table 1: Key Genomic Features of YDR215C

FeatureInformationExperimental Relevance
Chromosomal LocationChromosome IVImportant for designing genomic modifications
ORF Size[Gene length from SGD]Affects cloning strategies and protein expression
GC Content[% from sequence analysis]Influences PCR conditions and codon optimization
Promoter Elements[Regulatory elements from SGD]Critical for expression studies and regulation analysis
Neighboring Genes[From genomic context]Potential for co-regulation or operon-like structures
Sequence Variations[Strain differences]May affect phenotype in different genetic backgrounds

When designing primers for amplification or manipulation of YDR215C, researchers should check for internal restriction sites that might interfere with cloning strategies. Additionally, codon usage should be optimized if expressing in heterologous systems. The reference genome sequence from strain S288C should be considered the standard, but it's important to verify the sequence in your specific laboratory strain as variations may exist .

How should researchers design experiments to determine the function of YDR215C?

Determining the function of an uncharacterized protein like YDR215C requires a multi-dimensional experimental approach:

  • Gene Deletion/Disruption Studies:

    • Create precise gene knockouts using CRISPR-Cas9 or traditional homologous recombination

    • Perform phenotypic analysis across diverse conditions (temperature, pH, carbon sources, stress)

    • Include both positive and negative controls (known genes with similar predicted features)

    • Use quantitative measurements rather than qualitative observations

  • Protein Interaction Studies:

    • Implement a staged approach beginning with in silico predictions

    • Perform yeast two-hybrid or protein-fragment complementation assays

    • Validate with co-immunoprecipitation and mass spectrometry

    • Map interaction domains through truncation mutants

  • Transcriptomic Response:

    • Compare wild-type and YDR215C deletion strains under multiple conditions

    • Use RNA-Seq with sufficient biological replicates (minimum n=3)

    • Validate key expression changes with RT-qPCR

    • Analyze data for enriched pathways and functional categories

The experimental design should include appropriate randomization, blinding where possible, and sufficient statistical power. Control for batch effects by distributing samples across experimental runs, and include technical replicates for validation of unusual or unexpected results .

What control conditions are essential when studying YDR215C expression patterns?

When studying YDR215C expression patterns, implementing proper controls is critical for generating reliable and interpretable data:

Table 2: Essential Controls for YDR215C Expression Studies

Control TypePurposeImplementation
Positive Expression ControlVerify assay functionalityInclude a constitutively expressed gene (e.g., ACT1, TDH3)
Negative Expression ControlEstablish background signalInclude a gene not expressed in conditions (e.g., GAL genes in glucose)
Empty Vector ControlControl for vector effectsTransform with same vector lacking YDR215C insert
Wild-type StrainBaseline comparisonIsogenic strain without modifications
Media-only ControlDetect contaminationNo cells, same media and conditions
Time-zero ControlEstablish baselineSample collected before experimental treatment
Cross-condition ControlNormalize between experimentsInclude standard condition across all experiments

When measuring expression response to environmental stressors, it's essential to monitor the expression of known stress-responsive genes (e.g., HSP12, CTT1) as internal controls to confirm that stress response pathways are properly activated. Additionally, researchers should standardize cell density at the start of experiments (typically OD600 = 0.1-0.3 for log phase studies) and maintain consistent sample processing times to minimize technical variability .

How can researchers efficiently optimize protein expression and purification protocols for recombinant YDR215C?

Optimizing expression and purification of recombinant YDR215C requires systematic parameter testing:

  • Expression System Selection:

    • E. coli: Test multiple strains (BL21(DE3), Rosetta, Arctic Express) for expression

    • S. cerevisiae: Consider constitutive (GPD) vs. inducible (GAL1) promoters

    • Insect cells: Baculovirus expression for complex proteins with modifications

  • Expression Optimization Matrix:

    • Temperature: Test 16°C, 25°C, 30°C, 37°C

    • Induction time: 4h, 8h, overnight, 24h

    • Inducer concentration: IPTG (0.1, 0.5, 1.0 mM) or galactose (0.5%, 1%, 2%)

    • Media: LB, TB, auto-induction, synthetic complete

    • Cell density at induction: OD600 = 0.6, 1.0, 1.5

  • Fusion Tag Selection:

    • Test multiple tags: His6, GST, MBP, SUMO

    • N-terminal vs. C-terminal placement

    • TEV or PreScission protease cleavage sites for tag removal

  • Purification Strategy Development:

    • Perform small-scale purifications first (1-10 mg)

    • Test buffer conditions (pH 6.0-8.0, NaCl 150-500 mM)

    • Screen stabilizing additives (glycerol, reducing agents, specific ions)

    • Implement multiple chromatography steps (affinity, ion exchange, size exclusion)

Initial small-scale expression tests should be performed in parallel with multiple conditions, analyzing results by SDS-PAGE and Western blotting. Once optimal conditions are identified, scale up gradually while monitoring protein quality. Protein stability should be assessed through thermal shift assays or limited proteolysis to identify stabilizing buffer conditions .

What are the most sensitive methods for detecting potential post-translational modifications of YDR215C?

Detecting post-translational modifications (PTMs) on YDR215C requires specialized analytical techniques:

  • Mass Spectrometry-Based Approaches:

    • Enrichment strategies for specific PTMs:

      • Phosphorylation: TiO2 or IMAC enrichment

      • Glycosylation: Lectin affinity or hydrazide chemistry

      • Ubiquitination: K-ε-GG antibody enrichment

    • MS analysis workflows:

      • Bottom-up proteomics with multiple proteases (trypsin, chymotrypsin)

      • Top-down proteomics for intact protein analysis

      • Middle-down approaches for larger peptide fragments

    • Quantitative strategies:

      • SILAC labeling for comparing conditions

      • TMT/iTRAQ for multiplexed analysis

  • Site-Specific Mutation Analysis:

    • Mutate predicted modification sites (S/T/Y for phosphorylation, K for ubiquitination)

    • Create non-modifiable (S→A) and phosphomimetic (S→D/E) mutations

    • Assess phenotypic consequences of mutation

  • Modification-Specific Detection:

    • Western blotting with modification-specific antibodies

    • Phos-tag gels for phosphorylation detection

    • Pro-Q Diamond/Emerald staining for phosphorylation/glycosylation

For integrative analysis, researchers should combine mass spectrometry data with evolutionary conservation analysis of potential modification sites. Sites conserved across fungal species are more likely to be functionally relevant. Additionally, modification prediction tools should be used to prioritize sites for experimental validation .

How can researchers resolve contradictory data when analyzing YDR215C function?

When facing contradictory data in YDR215C functional studies, a systematic troubleshooting approach is essential:

  • Data Validation Protocol:

    • Repeat experiments with increased replication (n≥5)

    • Use alternative methodologies to test the same hypothesis

    • Sequence verify all strains and plasmids to exclude mutations

    • Test in multiple genetic backgrounds to identify strain-specific effects

    • Implement blinded analysis when possible

  • Contradiction Analysis Framework:

    • Identify specific variables that differ between contradictory experiments

    • Test these variables systematically in controlled experiments

    • Consider conditional functionality (strain-specific, media-dependent, temperature-sensitive)

    • Examine temporal dynamics with time-course experiments

  • Data Integration Strategies:

    • Weight evidence based on methodological robustness

    • Consider biological context and pathway knowledge

    • Use computational modeling to reconcile differing datasets

    • Develop testable hypotheses to explain apparent contradictions

Table 3: Contradiction Resolution Framework for YDR215C Studies

Type of ContradictionPotential CausesResolution Strategies
Phenotypic differencesGenetic background effectsTest in isogenic strains with single mutations
Localization discrepanciesTag interference, condition-specificUse multiple tags, native antibodies, live vs. fixed imaging
Interaction partner variabilityMethod-specific biases, stringency differencesValidate with orthogonal methods, titrate interaction conditions
Expression level disagreementGrowth phase differences, media effectsStandardize growth conditions, use internal controls
Functional attribution conflictsPleiotropic effects, indirect consequencesPerform epistasis analysis, conditional alleles, time-resolved studies

When reporting contradictory results, researchers should present all data transparently and discuss potential explanations for discrepancies rather than selectively reporting supporting evidence .

What computational approaches can predict potential functions of YDR215C?

Computational prediction of YDR215C function should employ multiple complementary approaches:

  • Sequence-Based Analysis:

    • Profile-based searches (PSI-BLAST, HHpred) to detect remote homologs

    • Motif identification (MEME, PROSITE) for functional domains

    • Disorder prediction (PONDR, IUPred) for structural characteristics

    • Coevolution analysis to identify functionally coupled residues

  • Structural Bioinformatics:

    • Ab initio structure prediction (AlphaFold, Rosetta)

    • Structure-based function prediction (ProFunc, COFACTOR)

    • Binding site prediction (SiteMap, FTSite)

    • Molecular dynamics simulations to identify conformational flexibility

  • Systems Biology Integration:

    • Gene neighborhood conservation analysis

    • Co-expression network integration (WGCNA)

    • Protein-protein interaction network analysis (STRING)

    • Phenomic data integration across multiple conditions

    • Pathway enrichment analysis of co-regulated genes

  • Comparative Genomics:

    • Phylogenetic profiling to identify co-evolving genes

    • Synteny analysis across fungal species

    • Selection pressure analysis (dN/dS) to identify conserved regions

To maximize predictive power, researchers should implement a consensus approach that integrates multiple lines of evidence, weighting each prediction by the method's historical accuracy for yeast proteins. Additionally, functional predictions should be validated experimentally, starting with the highest confidence predictions generated through computational consensus methods .

What genetic interaction methods are most informative for characterizing YDR215C function?

Genetic interaction analysis provides powerful insights into YDR215C function through systematic perturbation approaches:

  • Synthetic Genetic Array (SGA) Analysis:

    • Cross YDR215C deletion with genome-wide deletion collection

    • Quantify genetic interactions through colony size measurement

    • Identify significant negative (synthetic sick/lethal) and positive (suppressive) interactions

    • Analyze interaction profiles for functional clustering

    • Implementation considerations:

      • Use specialized SGA reporter strains

      • Include multiple biological replicates (n≥3)

      • Normalize for plate position effects and growth rate differences

  • CRISPR-Based Interaction Screens:

    • Generate YDR215C deletion or CRISPRi knockdown strain

    • Transform with genome-wide sgRNA library

    • Use barcode sequencing to identify enriched/depleted sgRNAs

    • Key optimization parameters:

      • Library coverage (≥500X)

      • Selection stringency calibration

      • Timepoint selection for dynamic range

  • Dosage Suppression Screening:

    • Overexpress genomic libraries in YDR215C mutant background

    • Select for phenotype suppression

    • Sequence and identify suppressor genes

    • Validate suppression with individual construct transformation

  • Targeted Epistasis Analysis:

    • Create double mutants with genes in predicted pathways

    • Perform quantitative phenotyping under multiple conditions

    • Analyze epistatic relationships to position YDR215C in pathways

The interpretation of genetic interaction data requires computational analysis to identify statistically significant interactions, clustering of interaction profiles, and enrichment of functional categories among interacting genes. Data visualization tools like interaction networks and hierarchical clustering can reveal functional modules and pathway relationships .

How can researchers determine if YDR215C is essential under specific environmental conditions?

To determine conditional essentiality of YDR215C, implement a systematic environmental profiling strategy:

  • Conditional Growth Assay Matrix:

    • Generate precise YDR215C deletion and complementation strains

    • Test growth across systematic environmental variations:

      • Carbon sources: glucose, galactose, glycerol, ethanol, acetate

      • Nitrogen sources: ammonium, amino acids, nucleobases

      • Temperatures: 16°C, 25°C, 30°C, 37°C, 42°C

      • pH values: 4.0, 5.5, 7.0, 8.0

      • Osmotic stress: NaCl, KCl, sorbitol at various concentrations

      • Oxidative stress: H2O2, diamide, menadione

      • Cell wall/membrane stress: SDS, Congo red, calcofluor white

      • Metal ions: Fe, Cu, Zn depletion and excess

      • Nutrient limitation: phosphate, sulfate restriction

    • Measure both growth rate and carrying capacity quantitatively

  • Quantitative Fitness Measurement Approaches:

    • Microplate reader growth curves for quantitative kinetic analysis

    • Automated colony size measurement on agar plates

    • Competitive growth with fluorescent wild-type reference strain

    • Deep sequencing of barcoded strains in pooled cultures

  • Inducible Depletion Systems:

    • Implement auxin-inducible degron tag on YDR215C

    • Create tetracycline-regulated expression system

    • Monitor effects of acute vs. chronic depletion

    • Assess recovery potential after temporary depletion

Table 4: Decision Matrix for Determining YDR215C Essentiality

Growth PatternWild-typeΔydrΔ215CComplementedInterpretation
Normal in all conditionsNormalNormalNormalNon-essential
Condition-specific defectNormalDefectiveNormalConditionally required
Complete lethalityNormalNo growthNormalEssential
Partial growth defectNormalSlow growthNormalFitness contribution
Suppression by specific nutrientsNormalCondition-dependentNormalMetabolic function

The most robust experimental designs will include multiple orthogonal measurements of viability and growth, positive and negative controls, and statistical analysis to determine significance of condition-specific effects .

What are the most effective strategies for analyzing potential protein-protein interactions involving YDR215C?

To comprehensively characterize the protein interaction network of YDR215C, employ a multi-method strategy:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Generate strains with epitope-tagged YDR215C (TAP, FLAG, HA)

    • Optimize lysis conditions to preserve interactions:

      • Test multiple detergents (NP-40, Triton X-100, digitonin)

      • Vary salt concentrations (100-500 mM NaCl)

      • Include protease and phosphatase inhibitors

    • Implement controls:

      • Untagged strain processed identically

      • Non-specific tag-only control

      • Non-expressing cell type as background

    • Perform quantitative MS comparison using SILAC or TMT labeling

    • Filter data using statistical confidence scores and abundance ratios

  • Proximity Labeling Methods:

    • Create BioID or TurboID fusions with YDR215C

    • Induce proximity labeling with biotin addition

    • Purify biotinylated proteins and identify by MS

    • Compare spatial interactome across cellular compartments

  • In Vitro Validation:

    • Express and purify recombinant YDR215C and candidate interactors

    • Perform direct binding assays:

      • Surface plasmon resonance

      • Isothermal titration calorimetry

      • Microscale thermophoresis

    • Map interaction domains through truncation analysis

  • Functional Validation:

    • Perform co-localization studies using fluorescent protein fusions

    • Implement genetic interaction tests between YDR215C and interactor genes

    • Test phenotypic consequences of disrupting specific interactions

The most robust interaction networks are built by integrating data from multiple techniques, scoring interactions based on detection across independent methods, and implementing computational filtering to distinguish primary from secondary interactions .

How should researchers approach a structural biology study of YDR215C?

A comprehensive structural biology investigation of YDR215C requires systematic preparation and multi-technique integration:

  • Protein Production Optimization:

    • Engineer constructs with varying boundaries based on:

      • Secondary structure predictions

      • Domain predictions

      • Disorder analysis

      • Evolutionary conservation

    • Test multiple expression systems:

      • Bacterial (E. coli)

      • Yeast (S. cerevisiae, P. pastoris)

      • Insect cells (Sf9, Hi5)

      • Mammalian cells (HEK293, CHO)

    • Implement high-throughput solubility screening

  • Technique Selection Decision Tree:

    • X-ray Crystallography:

      • Initial crystallization trials (sparse matrix screens)

      • Optimization of promising conditions

      • Data collection strategy planning

      • Phase determination approach selection

    • Cryo-Electron Microscopy:

      • Sample homogeneity assessment

      • Grid preparation optimization

      • Collection strategy development

      • Processing pipeline establishment

    • NMR Spectroscopy:

      • Isotopic labeling strategy (15N, 13C, 2H)

      • Spectral acquisition planning

      • Assignment strategy development

  • Integrated Structural Biology:

    • Combine multiple structural techniques

    • Incorporate computational modeling

    • Validate with biophysical techniques:

      • Circular dichroism

      • Small-angle X-ray scattering

      • Analytical ultracentrifugation

      • Hydrogen-deuterium exchange MS

Table 5: Structural Biology Technique Selection Guide for YDR215C

Protein CharacteristicPreferred TechniquesSample RequirementsResolution Range
<30 kDa, solubleNMR, X-ray15N/13C labeled, 5-10 mg/ml1.5-3.0 Å
30-150 kDa, stableX-ray, Cryo-EM10-20 mg/ml, homogeneous2.0-4.0 Å
>150 kDa, complexCryo-EM1-5 mg/ml, stable2.5-4.5 Å
Membrane-associatedCryo-EM, X-ray (LCP)Detergent/nanodisc, stable3.0-4.5 Å
Flexible regionsIntegrative methodsMultiple preparationsVariable

The structural biology workflow should be iterative, with feedback between expression, purification, and structural determination steps. Initial low-resolution models can guide construct optimization for higher-resolution studies .

What key challenges remain in understanding YDR215C function and how might they be addressed?

The characterization of uncharacterized proteins like YDR215C presents several persistent challenges that require innovative approaches:

  • Technical Challenges:

    • Low expression levels limiting detection

    • Potential redundancy masking phenotypes

    • Condition-specific functionality

    • Complex multi-protein assemblies

  • Methodological Approaches:

    • Implement sensitive detection methods like single-cell analysis

    • Develop conditional alleles (temperature-sensitive, auxin-inducible)

    • Create synthetic genetic backgrounds (double/triple mutants)

    • Apply unbiased multi-omics profiling across diverse conditions

    • Utilize cross-species complementation to test conserved functions

  • Integrative Strategies:

    • Combine computational predictions with targeted experiments

    • Develop probabilistic functional models integrating multiple data types

    • Apply machine learning to predict condition-specific requirements

    • Utilize evolutionary analysis to identify conserved functional elements

Future research on YDR215C would benefit from community resources and standardized protocols to facilitate data integration and comparison across laboratories. Researchers should prioritize publishing negative results to prevent duplication of unsuccessful approaches and consider open science practices to accelerate functional characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.