Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR269C (YDR269C)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR269C (YDR269C) is a recombinantly expressed protein derived from the S. cerevisiae genome. While its precise biological function remains elusive, its study is critical for advancing functional genomics in yeast. This article synthesizes available biochemical, genetic, and experimental data to provide a structured overview of its properties, research applications, and insights from functional studies.

Fitness Profiling and Phenotypic Analysis

A genome-wide fitness profiling study identified YDR269C as a gene required for optimal growth under specific conditions:

Growth ConditionObserved Phenotype
GalactoseReduced fitness (44–91% wild-type growth)
High Salt/SorbitolNo significant sensitivity reported
pH 8.0No significant sensitivity reported

Experimental Uses

YDR269C is utilized in:

  • ELISA Assays: For quantitative detection of the protein in experimental samples .

  • Protein Interaction Studies: To investigate potential binding partners (e.g., via co-immunoprecipitation).

  • Functional Genomics: To study its role in metabolic pathways or stress responses .

Knowledge Gaps

  • Lack of Functional Annotation: No GO terms or phenotypic annotations are associated with YDR269C in SGD .

  • Limited Interaction Data: No physical or genetic interactions reported in BioGRID .

Prioritized Research Areas

  1. Enzymatic Activity: Testing for catalytic functions (e.g., hydrolase, kinase).

  2. Metabolic Pathway Integration: Linking YDR269C to galactose metabolism or iron homeostasis (e.g., via Aft1-regulated pathways ).

  3. Structural Analysis: Solving the 3D structure to infer functional domains.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
YDR269C; Putative uncharacterized protein YDR269C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR269C
Target Protein Sequence
MPSTCLVTVETQDPQVIPCTLSSPSFVLMAVISESLSISQSNPQSSIISLIESAVTSLSY VTWHSLVTKLISHFVTPFKARNCVLIVLVQALHVIPCTASITSLISF
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR269C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YDR269C and why is it significant for research?

YDR269C is a putative uncharacterized protein in Saccharomyces cerevisiae with UniProt Primary Accession #P87281. Its significance stems from its genomic overlap with the CCC2 gene, which encodes a copper-transporting P-type ATPase essential for iron uptake. Current annotations describe YDR269C as a "product of a dubious gene prediction" with potential membrane localization as a multi-pass membrane protein . Research interest in YDR269C has increased due to findings that strains with deletions in this region display hypersensitivity to compounds like curcumin, suggesting potential roles in metal ion homeostasis or cellular stress responses .

What are the key structural features and physicochemical properties of YDR269C?

YDR269C is predicted to be a membrane-associated protein with multiple transmembrane domains. While detailed structural information remains limited, bioinformatic analysis suggests:

PropertyValue/Prediction
Subcellular locationMembrane; Multi-pass membrane protein (Potential)
Theoretical pIWithin range 4.05-11.99 (typical for membrane proteins)
StabilityLikely stable (instability index <40)
HydrophobicityNegative GRAVY value (indicating non-polar nature)
Secretory natureNon-secretory (>87% probability)

Researchers should note that these properties are computational predictions that require experimental validation. For accurate characterization, employ techniques such as circular dichroism spectroscopy for secondary structure analysis, hydrophobicity plots using Kyte-Doolittle scale analysis, and stability assays under various pH and temperature conditions .

What are the optimal conditions for recombinant expression of YDR269C in S. cerevisiae?

For successful recombinant expression of YDR269C, consider these methodological approaches:

  • Vector Selection: Utilize a high-copy 2µM expression plasmid such as pGI-100 with a constitutive promoter like TEF2 (translation elongation factor 1-alpha) rather than inducible promoters for consistent expression .

  • Primer Design: Design primers that specifically amplify the YDR269C sequence while avoiding overlap with the CCC2 gene. Example primers based on similar successful constructs might include:

    • Forward: 5'-CGGAATTC[START CODON + YDR269C SEQUENCE]-3'

    • Reverse: 5'-ATAAGAATGCGGCCGC[STOP CODON + TAG SEQUENCE]-3'

  • Growth Conditions: Optimal growth at 30°C in YPD medium (yeast extract-peptone-dextrose) to an OD600 of 2.0, as demonstrated in similar S. cerevisiae expression systems .

  • Expression Verification: Confirm expression using Western blot analysis with antibodies against a C-terminal tag (His-tag recommended due to lack of specific YDR269C antibodies) .

How can researchers overcome challenges in purifying membrane-associated proteins like YDR269C?

Purification of membrane proteins like YDR269C presents several technical challenges. Implement this methodological workflow:

  • Cell Disruption: Use mechanical disruption (glass beads or French pressure cell) rather than enzymatic methods to effectively break the yeast cell wall while preserving membrane structures.

  • Membrane Fraction Isolation: Perform differential centrifugation (1,000g for 10 min to remove cell debris, followed by 100,000g for 1 hour to isolate membrane fractions).

  • Detergent Solubilization: Test multiple detergents for optimal solubilization:

    DetergentConcentrationAdvantagesLimitations
    n-Dodecyl β-D-maltoside (DDM)1-2%Gentle, preserves functionExpensive
    Triton X-1000.5-1%Effective, low costMay affect activity
    Digitonin0.5-1%Maintains protein-protein interactionsLimited solubilization
  • Affinity Chromatography: Employ immobilized metal affinity chromatography (IMAC) with Ni-NTA resin for His-tagged constructs, followed by size exclusion chromatography to remove aggregates and improve purity.

  • Quality Assessment: Verify purification success using SDS-PAGE with Coomassie staining and Western blot analysis.

What experimental methods are most effective for determining YDR269C's role in iron and copper homeostasis?

Given the genetic relationship between YDR269C and CCC2, several approaches can elucidate its potential role in metal homeostasis:

  • Growth Phenotype Analysis: Compare growth of wild-type, YDR269C deletion, and CCC2 deletion strains under varying iron and copper concentrations. Culture cells in YPD medium supplemented with iron chelators (80μM BPS) or copper chelators, with and without iron/copper supplementation (50μM Fe2SO4) .

  • Metal Content Quantification: Use inductively coupled plasma mass spectrometry (ICP-MS) to measure intracellular iron and copper levels in wild-type versus mutant strains.

  • Gene Expression Analysis: Employ RT-qPCR to measure expression of iron-responsive genes (FET3, FTR1) and copper-responsive genes (CTR1, MAC1) in YDR269C mutants versus wild-type under normal and metal-limited conditions .

  • Protein-Protein Interaction Studies: Perform co-immunoprecipitation experiments to identify potential interactions between YDR269C and known components of the copper and iron transport machinery.

  • Localization Studies: Use fluorescence microscopy with GFP-tagged YDR269C to determine subcellular localization and potential co-localization with Ccc2p or other metal transport proteins.

How can researchers differentiate between direct effects of YDR269C mutation and indirect effects due to CCC2 disruption?

This represents a significant challenge due to the genomic overlap. Implement these methodological approaches:

  • Complementation Assays: Transform YDR269C deletion strains with plasmids expressing either YDR269C alone, CCC2 alone, or both genes, then assess phenotype rescue.

  • Site-Directed Mutagenesis: Introduce point mutations that affect YDR269C but not CCC2 (or vice versa) based on careful sequence analysis, then assess the resulting phenotypes.

  • CRISPR-Cas9 Precise Editing: Use CRISPR-Cas9 genome editing to create specific mutations or truncations that affect only one gene without disrupting the other.

  • Heterologous Expression: Express YDR269C in a heterologous system lacking CCC2 homologs to assess its independent function.

  • Domain Mapping: Identify functional domains through truncation analysis and determine which regions are essential for complementing phenotypes associated with YDR269C/CCC2 deletion.

What computational approaches can predict potential functions of YDR269C when experimental data is limited?

Advanced in silico characterization can provide crucial insights:

  • Comparative Genomics: Analyze conservation of YDR269C across fungal species to identify conserved regions potentially important for function.

  • Protein Structure Prediction: Use AlphaFold or RoseTTAFold to generate structural models, then conduct molecular dynamics simulations to predict protein behavior.

  • Functional Domain Analysis: Search for conserved domains using tools like PFAM, SMART, and InterPro that might suggest functional roles.

  • Molecular Docking: Perform in silico docking of potential ligands (particularly metal ions) to identify potential binding sites.

  • Co-expression Network Analysis: Analyze transcriptomic data to identify genes co-expressed with YDR269C across various conditions, suggesting functional relationships.

The integration of these computational approaches has successfully characterized uncharacterized proteins in multiple strains, as demonstrated in recent genomic studies .

How does YDR269C contribute to curcumin sensitivity in S. cerevisiae?

Research has demonstrated that YDR269C deletion strains exhibit hypersensitivity to curcumin, suggesting a functional role in stress response or detoxification pathways. To investigate this relationship:

  • Dose-Response Assays: Conduct quantitative growth assays with varying curcumin concentrations (50-150μM) in wild-type and mutant strains to establish precise sensitivity profiles .

  • Transcriptomic Analysis: Perform RNA-seq comparing gene expression in wild-type and YDR269C mutants treated with curcumin to identify affected pathways.

  • Metabolomic Profiling: Use LC-MS to analyze metabolite changes in response to curcumin treatment in wild-type versus YDR269C mutant strains.

  • Genetic Interaction Screening: Perform synthetic genetic array analysis with YDR269C deletion strain to identify genetic interactions enhanced or suppressed by curcumin exposure.

Recent studies have shown that 8 out of 17 identified genes in curcumin-hypersensitive strains encode products functioning in transport and homeostasis of iron and copper ions, suggesting YDR269C may participate in these pathways :

Biological ProcessAssociated Genes
Iron ion import/homeostasisFET3, FTR1, AFT1
Copper ion import/homeostasisCTR1, MAC1
Copper and iron homeostasisATX1, GEF1, CCC2/YDR269C

What control strains should be included when studying YDR269C function?

For robust experimental design, include these essential controls:

  • Wild-type S. cerevisiae: Preferably the parent strain from which the YDR269C mutant was derived (BY4743 is commonly used in deletion studies) .

  • CCC2 deletion strain: Essential for distinguishing between YDR269C and CCC2 effects.

  • YDR269C complemented strain: YDR269C deletion strain transformed with a plasmid expressing functional YDR269C.

  • Related mutants: Include strains with deletions in genes involved in iron/copper homeostasis (ATX1, GEF1) for comparative analysis .

  • Double mutants: When assessing genetic interactions, create double mutants of YDR269C with related pathway genes.

What are the key considerations for immunological studies involving recombinant YDR269C?

When designing immunological studies:

  • Antigen Preparation: Express recombinant YDR269C with appropriate tags (His or GST) to facilitate purification while minimizing structural disruption.

  • Antibody Production: Due to the membrane-associated nature of YDR269C, select specific antigenic epitopes from predicted extracellular regions or use synthetic peptides corresponding to unique sequences for antibody generation.

  • Specificity Testing: Rigorously validate antibody specificity using western blots comparing wild-type and YDR269C deletion strains, as well as competition assays with purified protein.

  • Cross-Reactivity Assessment: Test for potential cross-reactivity with Ccc2p due to sequence overlap.

  • Appropriate Controls: Include pre-immune serum controls and peptide competition assays to confirm specificity of immunological detection.

  • Application-Specific Optimization: Adjust fixation and permeabilization methods for immunofluorescence studies to preserve membrane structure and epitope accessibility.

How should researchers interpret contradictory findings regarding YDR269C function?

When faced with contradictory data:

  • Strain Background Differences: Compare genetic backgrounds of strains used in different studies; phenotypic differences may result from strain-specific genetic modifiers.

  • Growth Condition Variations: Analyze experimental conditions including media composition, temperature, and growth phase, as YDR269C function may be condition-dependent.

  • Technical Approach Differences: Consider methodological variations in protein expression systems, tagging strategies, or assay sensitivities.

  • Gene Annotation Issues: Remember that YDR269C is annotated as a "dubious ORF" and may have different functional impacts depending on how precisely the deletion was engineered.

  • Pleiotropic Effects: Consider indirect effects through disruption of CCC2 or other overlapping genetic elements.

Data integration approaches, including meta-analysis of multiple studies and correlative analysis across diverse experimental conditions, can help resolve apparent contradictions.

What are common pitfalls in recombinant YDR269C expression and how can they be addressed?

Researchers commonly encounter these challenges:

  • Poor Expression Levels:

    • Problem: Low protein yield despite confirmed gene insertion

    • Solution: Optimize codon usage for S. cerevisiae, use stronger constitutive promoters like TEF2, and culture at lower temperatures (23-27°C) to improve protein folding

  • Protein Misfolding:

    • Problem: Expression leads to aggregated or non-functional protein

    • Solution: Express with chaperone co-expression systems, reduce expression temperature, or use fusion partners that enhance solubility

  • Toxicity Issues:

    • Problem: Expression causes growth inhibition

    • Solution: Use regulatable promoters, express in specialized strains with modified metal homeostasis systems, or use lower copy number plasmids

  • Purification Challenges:

    • Problem: Difficulty extracting from membrane fractions

    • Solution: Screen multiple detergents for optimal solubilization, use shorter purification protocols to minimize degradation, and include protease inhibitors throughout the process

  • Functional Assessment:

    • Problem: Unclear if purified protein retains native activity

    • Solution: Develop robust activity assays based on predicted function in metal binding or transport, and compare with positive controls like purified Ccc2p

What emerging technologies might advance understanding of YDR269C function?

Several cutting-edge approaches offer promising avenues for future research:

  • Cryo-Electron Microscopy: To determine high-resolution structures of YDR269C within membrane environments, potentially revealing functional domains and interaction surfaces.

  • Proximity Labeling: Techniques like BioID or APEX2 fusion to identify proteins in close proximity to YDR269C in living cells, revealing the protein's interaction network.

  • Single-Cell Transcriptomics: To analyze cell-to-cell variability in YDR269C expression and its correlation with phenotypic heterogeneity in stress responses.

  • Microfluidics-Based Phenotyping: For high-throughput analysis of YDR269C mutant responses to various stressors and metal concentrations at the single-cell level.

  • CRISPR Activation/Interference: To modulate YDR269C expression without complete deletion, allowing more nuanced analysis of dosage effects.

  • Integrative Multi-Omics: Combining proteomics, metabolomics, and transcriptomics to build comprehensive models of YDR269C function within cellular networks.

How might research on YDR269C contribute to broader understanding of eukaryotic protein function?

Studies of YDR269C have implications beyond yeast biology:

  • Methodology Development: Approaches for characterizing membrane-associated uncharacterized proteins can be applied to the substantial fraction of eukaryotic genomes still lacking functional annotation.

  • Evolutionary Conservation Analysis: Comparative studies across fungal species can reveal evolutionarily conserved mechanisms of metal homeostasis.

  • Stress Response Mechanisms: Understanding YDR269C's role in curcumin sensitivity may elucidate broader principles of cellular stress responses applicable across eukaryotic systems.

  • Gene Overlap Resolution: Methodologies developed to disambiguate YDR269C/CCC2 functions can inform approaches to studying other overlapping genetic elements in complex genomes.

  • Translational Applications: Insights into metal homeostasis mechanisms may inform therapeutic approaches for human diseases involving disrupted metal transport, such as Wilson's disease and hemochromatosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.