Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR290W (YDR290W)

Shipped with Ice Packs
In Stock

Description

Research Findings and Functional Insights

YDR290W is annotated as a "dubious ORF" in the S. cerevisiae genome database (SGD), with no confirmed biological function . Key insights include:

  • Genomic Classification: Labeled as "unlikely to encode a functional protein" due to limited experimental evidence .

  • Expression and Purification: Recombinant production in E. coli suggests efforts to study its structure or potential roles in yeast biology .

  • Functional Hypotheses: While no direct studies link YDR290W to specific pathways, its expression in genome-wide instability screens (e.g., bioRxiv preprint ) hints at potential involvement in DNA repair or stress response.

Table 3: YDR290W in Genomic Studies

Study TypeObservationSource
Genome-wide screensIdentified in DNA damage response contexts (no functional data)
Protein synthesisNo reported role in muscle protein synthesis or leucine signaling

Applications in Research and Biotechnology

Recombinant YDR290W serves as a tool for:

  • Structural Biology: His-tagged variants enable crystallography or NMR studies to elucidate its tertiary structure .

  • ELISA Development: Used in assays to detect antibodies or binding partners .

  • Functional Screens: Included in libraries to identify novel protein interactions or enzymatic activities .

Challenges and Future Directions

Despite commercial availability, YDR290W remains poorly characterized. Critical gaps include:

  • Functional Annotation: No evidence for catalytic activity, protein-protein interactions, or subcellular localization.

  • Evolutionary Conservation: Limited homology to proteins in other organisms, complicating functional inference. Future research should focus on in vivo expression studies or high-throughput interaction mapping to resolve its biological role.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your request.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YDR290W; Putative uncharacterized protein YDR290W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR290W
Target Protein Sequence
MYSFHISATLGASLYCRSNHFEALEIDSWESSNVFNLVVNCSEEKGIPSILILDYCFLQI FYLFVKTFFACTYIIMLAFQVYIFLKEKNNFFIFRYKTEPLYILRWLRS
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR290W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YDR290W and why is it significant in S. cerevisiae research?

YDR290W is a putative uncharacterized protein found in the yeast Saccharomyces cerevisiae with a full length of 109 amino acids . The significance of this protein lies in its uncharacterized nature, making it an important target for functional genomics studies in yeast. As S. cerevisiae serves as a model eukaryotic organism in molecular biology research, understanding previously uncharacterized proteins like YDR290W contributes to our comprehensive knowledge of yeast biology, cellular processes, and potentially homologous proteins in higher eukaryotes.

While its specific biological role remains unclear, investigating YDR290W helps advance our understanding of the approximately 20% of yeast genes that remain functionally uncharacterized despite the organism's extensively studied genome. Methodologically, researchers typically approach uncharacterized proteins through sequence analysis, structural prediction, gene expression analysis under various conditions, and phenotypic characterization of deletion mutants.

What structural features have been identified in YDR290W protein?

The YDR290W protein consists of 109 amino acids in its full-length form . While detailed structural information is limited in the available search results, recombinant forms of this protein have been successfully expressed with histidine tags, suggesting the protein is amenable to heterologous expression and purification systems.

For uncharacterized proteins like YDR290W, researchers typically employ computational approaches to predict structural features, including:

  • Secondary structure prediction using algorithms like PSIPRED, JPred, or SOPMA

  • Tertiary structure modeling using homology modeling or ab initio prediction tools like I-TASSER or Rosetta

  • Domain identification using databases such as PFAM, SMART, or InterPro

  • Transmembrane region prediction using tools like TMHMM or Phobius

  • Post-translational modification site prediction using NetPhos, NetOGlyc, or similar tools

Experimental approaches to validate these predictions might include circular dichroism spectroscopy to analyze secondary structure content, limited proteolysis to identify domain boundaries, and ultimately X-ray crystallography or NMR spectroscopy for high-resolution structural determination.

What expression systems are most effective for producing recombinant YDR290W protein?

The recombinant YDR290W protein has been successfully expressed in E. coli expression systems with histidine tags . For researchers seeking to produce this protein, several methodological considerations should be taken into account:

  • Expression host selection: While E. coli is commonly used for initial expression attempts due to its simplicity and high yield, eukaryotic expression systems like Pichia pastoris might provide better folding for yeast proteins. For YDR290W specifically, E. coli appears to be a viable expression host based on available commercial sources.

  • Affinity tag selection: Histidine tags have been successfully employed for YDR290W , facilitating purification via immobilized metal affinity chromatography (IMAC). Alternative tags like GST, MBP, or SUMO might be considered if solubility issues arise.

  • Expression optimization parameters:

    • Induction conditions (temperature, inducer concentration, induction time)

    • Media composition and supplementation

    • Codon optimization for the expression host

    • Co-expression with chaperones if folding issues are observed

  • Purification strategy development:

    • IMAC as the primary purification step

    • Secondary purification via ion exchange or size exclusion chromatography

    • Buffer optimization to maintain protein stability

For researchers working with this protein, starting with the established E. coli expression system with His-tagging represents the most validated approach based on current data.

What approaches can be used to determine the biological function of YDR290W?

Determining the function of uncharacterized proteins like YDR290W requires a multi-faceted approach combining computational predictions and experimental validation:

  • Computational functional prediction:

    • Sequence-based homology searches against characterized proteins

    • Identification of conserved motifs or domains

    • Structural similarity to proteins of known function

    • Gene neighborhood analysis and phylogenetic profiling

  • Transcriptomic analysis:

    • Examining expression patterns across different growth conditions

    • Co-expression analysis to identify functionally related genes

    • Response to environmental stressors or nutrient limitations

  • Genetic approaches:

    • Phenotypic characterization of YDR290W deletion mutants

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • Multicopy suppression screening

    • CRISPR-based functional genomics screens

  • Biochemical characterization:

    • Protein-protein interaction studies (yeast two-hybrid, co-immunoprecipitation)

    • Subcellular localization determination

    • In vitro activity assays based on predicted functions

    • Metabolomic profiling of deletion mutants

  • Systems biology approaches:

    • Integration of multiple datasets (transcriptomic, proteomic, metabolomic)

    • Network analysis to place YDR290W in functional pathways

    • Comparison with datasets from related yeast species

The combination of these approaches allows researchers to develop and test hypotheses about YDR290W function, moving from broad possibilities to specific biochemical roles.

How can researchers effectively use S. cerevisiae ghost cells as an experimental system for studying YDR290W?

S. cerevisiae ghost cells represent an innovative experimental system that could be applied to YDR290W research. Ghost cells are empty cellular envelopes prepared by evacuating the cytoplasmic content while maintaining the 3D structure . For YDR290W studies, this system offers several unique research opportunities:

  • Protein localization and membrane association studies:

    • If YDR290W has membrane associations, ghost cells can reveal its distribution pattern

    • Immunofluorescence microscopy using anti-YDR290W antibodies on ghost preparations

    • Comparison of ghost preparation with and without YDR290W to identify structural roles

  • Interaction studies:

    • Using ghost cells as scaffolds to study YDR290W interactions with cell wall or membrane components

    • Reconstitution experiments where purified YDR290W is added to ghost cells to observe binding patterns

  • Preparation methodology for S. cerevisiae ghosts:

    • Treatment with Minimum Inhibitory Concentrations (MIC) of NaOH, SDS, NaHCO₃, and H₂O₂ in sequence

    • Use of decantation rather than centrifugation to prevent shrinking or self-adhering

    • Final preservation in 60% ethanol at 4°C

    • Quality assessment via light microscopy and scanning electron microscopy

  • Experimental advantages:

    • Reduction of background from cytoplasmic proteins

    • Preservation of cell wall and membrane architecture

    • Ability to study protein-cell envelope interactions in isolation

  • Limitations and considerations:

    • Ghost preparation may disrupt native protein associations

    • Some cell wall proteins might be lost during the preparation process

    • Need for validation using complementary approaches

This approach represents an advanced technique particularly useful for researchers investigating potential structural roles or membrane/cell wall associations of YDR290W.

What are the challenges in differentiating between direct and indirect effects when studying YDR290W knockout phenotypes?

When analyzing phenotypes resulting from YDR290W deletion, researchers face significant challenges in distinguishing direct effects from indirect consequences:

  • Primary vs. secondary effects distinction:

    • Primary effects directly result from YDR290W absence

    • Secondary effects arise from cellular compensation mechanisms

    • Tertiary effects emerge from systemic adaptation to the mutation

  • Methodological approaches to address this challenge:

    • Acute depletion systems (e.g., auxin-inducible degron tags) to observe immediate effects before compensation occurs

    • Time-course experiments following YDR290W deletion or depletion

    • Complementation studies with controlled expression levels

    • Comparison of phenotypes across different genetic backgrounds

  • Data analysis strategies:

    • Integration of multiple omics datasets (transcriptomics, proteomics, metabolomics)

    • Pathway enrichment analysis to identify affected processes

    • Network modeling to predict direct targets

    • Comparison with datasets from related uncharacterized proteins

  • Experimental design considerations:

    • Use of conditional alleles with varying severity

    • Analysis under different environmental conditions

    • Study of epistatic relationships with known pathway components

    • Structure-function studies with mutated versions of YDR290W

  • Validation approaches:

    • In vitro reconstitution of presumed direct interactions

    • Development of specific biochemical assays based on observed phenotypes

    • Cross-species complementation experiments

    • CRISPR interference for partial knockdown phenotypes

By implementing these methodological approaches, researchers can build a hierarchical model of YDR290W-dependent processes, distinguishing between direct functional roles and downstream consequences of its absence.

What is the optimal approach for generating and confirming YDR290W deletion mutants?

Creating and validating YDR290W deletion mutants requires meticulous experimental design:

  • Deletion strategy selection:

    • PCR-based gene replacement using selectable markers (e.g., KanMX, HIS3)

    • CRISPR-Cas9 mediated deletion

    • Recombineering approaches for scarless deletions

  • Confirmation methodologies (multi-level validation):

    • PCR verification with primers spanning deletion junctions

    • Southern blot analysis for complex loci

    • RT-PCR or northern blot to confirm absence of transcript

    • Western blot with specific antibodies to confirm protein absence

    • Whole genome sequencing to verify deletion and check for off-target effects

  • Strain construction considerations:

    • Use of different genetic backgrounds (BY4741, W303, S288C)

    • Generation of homozygous diploid deletions for essentiality assessment

    • Construction of complemented strains with wild-type YDR290W

    • Development of conditional alleles if deletion proves lethal

  • Phenotypic validation:

    • Growth rate determination under various conditions

    • Microscopic examination for morphological abnormalities

    • Specific assays based on predicted YDR290W function

    • Comparison with published deletion phenotypes from genome-wide studies

  • Potential pitfalls and solutions:

    • Neighboring gene effects: design deletions to minimize impact on adjacent genes

    • Suppressor mutations: use freshly generated deletions for experiments

    • Strain background effects: validate key findings in multiple backgrounds

    • Phenotypic drift: maintain frozen stocks of original isolates

This comprehensive approach ensures that observed phenotypes genuinely result from YDR290W deletion rather than technical artifacts or secondary mutations.

What expression systems and purification strategies yield the highest quality recombinant YDR290W for structural studies?

Obtaining high-quality recombinant YDR290W protein suitable for structural studies requires optimization of expression and purification protocols:

  • Expression system selection:

    • E. coli: Successful expression has been reported with His-tagged constructs

    • Common strains: BL21(DE3), Rosetta, SHuffle (for disulfide bonds)

    • Vector considerations: T7 promoter-based systems with tunable expression

    • Alternative eukaryotic systems: P. pastoris, S. cerevisiae, insect cells

  • Construct optimization:

    • Full-length protein (1-109 amino acids) versus domain-based constructs

    • Tag placement (N- or C-terminal) based on structural predictions

    • Inclusion of cleavable tags (TEV, PreScission protease sites)

    • Codon optimization for expression host

  • Expression condition optimization:

    • Temperature screening (15-37°C)

    • Induction parameters (IPTG concentration, induction time)

    • Media formulation (rich vs. minimal, supplementation strategies)

    • Co-expression with molecular chaperones if solubility is problematic

  • Multi-step purification strategy:

    • Initial capture: IMAC for His-tagged constructs

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer optimization throughout process (pH, salt, additives)

  • Quality assessment for structural studies:

    • Purity analysis: SDS-PAGE, mass spectrometry

    • Homogeneity: Dynamic light scattering, analytical SEC

    • Structural integrity: Circular dichroism, thermal shift assays

    • Crystallization pre-screening: Differential scanning fluorimetry

    • NMR suitability: 1D proton NMR

  • Crystallization considerations:

    • Surface entropy reduction mutations

    • In situ proteolysis approaches

    • Complexation with binding partners

    • Nanobody-assisted crystallization

These methodological considerations provide a roadmap for researchers seeking to produce YDR290W protein suitable for high-resolution structural studies.

How can researchers establish reliable protein-protein interaction networks for YDR290W?

Determining protein-protein interactions (PPIs) for uncharacterized proteins like YDR290W requires a multi-method approach:

  • Binary interaction detection methods:

    • Yeast two-hybrid (Y2H) screening against genomic or cDNA libraries

    • Protein complementation assays (split-GFP, split-luciferase)

    • In vitro methods: Surface plasmon resonance, isothermal titration calorimetry

    • Crosslinking mass spectrometry for transient interactions

  • Co-complex identification approaches:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • BioID or TurboID proximity labeling with YDR290W as bait

    • Co-immunoprecipitation with specific antibodies

    • Quantitative interactomics using SILAC or TMT labeling

  • Experimental design considerations:

    • Expression level control (endogenous vs. overexpression)

    • Tag interference assessment (N- vs. C-terminal tags)

    • Condition-dependent interactions (nutrient availability, stress conditions)

    • Detergent selection for membrane-associated complexes

  • Data analysis and validation:

    • Statistical filtering to distinguish true interactions from background

    • Comparison with published interactome datasets

    • Network analysis to identify interaction clusters

    • GO term enrichment of interaction partners

  • Functional validation approaches:

    • Genetic interaction analysis between YDR290W and identified partners

    • Co-localization studies using fluorescence microscopy

    • Mutational analysis of predicted interaction interfaces

    • In vitro reconstitution of key interactions

  • Data integration table format:

Interaction MethodAdvantagesLimitationsApplication to YDR290W
Yeast Two-HybridDetects binary interactions, in vivo contextHigh false positive/negative ratesScreen against full proteome or targeted library
AP-MSIdentifies physiological complexesMay miss transient interactionsPurify YDR290W-containing complexes under various conditions
BioID/TurboIDCaptures transient/weak interactionsProximity not always interactionMap YDR290W neighborhood in living cells
Crosslinking MSProvides structural informationComplex data analysisIdentify direct binding interfaces

By employing multiple complementary techniques, researchers can build confidence in the identified interactions and establish a reliable interaction network for YDR290W.

How should researchers interpret contradictory phenotypic data from YDR290W studies?

When faced with contradictory phenotypic data regarding YDR290W function, researchers should implement a systematic approach to reconciliation:

  • Sources of contradictory data in YDR290W research:

    • Different strain backgrounds (BY4741 vs. W303 vs. clinical isolates)

    • Variation in experimental conditions (media, temperature, growth phase)

    • Methodological differences in phenotypic assessment

    • Secondary mutations in laboratory strains

    • Different YDR290W alleles or expression levels

  • Systematic resolution approach:

    • Direct side-by-side comparison under identical conditions

    • Genetic complementation testing

    • Whole genome sequencing to identify secondary mutations

    • Reconstruction of mutations in clean genetic backgrounds

    • Quantitative assessment of phenotype penetrance and expressivity

  • Experimental validation strategies:

    • Gene dosage analysis (heterozygous vs. homozygous phenotypes)

    • Rescue experiments with controlled expression levels

    • Structure-function studies with mutant alleles

    • Cross-species complementation tests

    • Epistasis testing with related pathway components

  • Interpretive framework development:

    • Context-dependent functional model (condition-specific roles)

    • Multi-functional protein hypothesis (distinct roles in different contexts)

    • Threshold effect model (phenotype dependent on expression level)

    • Synthetic interaction model (phenotype requires specific genetic background)

  • Meta-analysis strategies:

    • Systematic review of methodologies across contradictory studies

    • Statistical assessment of effect sizes and reproducibility

    • Integration with broader datasets (genetic interaction profiles, expression data)

    • Development of standardized phenotyping protocols

By applying these approaches, researchers can transform contradictory data from a research obstacle into valuable insights about condition-specific or context-dependent functions of YDR290W.

What bioinformatic approaches are most effective for predicting YDR290W function?

Computational prediction of function for uncharacterized proteins like YDR290W benefits from integrating multiple bioinformatic approaches:

  • Sequence-based methods:

    • Homology detection through PSI-BLAST, HHpred, or HMMER

    • Motif identification using MEME, PROSITE, or ELM

    • Disorder prediction with PONDR or IUPred

    • Transmembrane topology prediction using TMHMM or Phobius

    • Signal peptide prediction with SignalP

  • Structure-based approaches:

    • Homology modeling using Phyre2, I-TASSER, or AlphaFold2

    • Structural comparison with DALI or TM-align

    • Binding site prediction using CASTp or FTMap

    • Molecular dynamics simulations to identify stable conformations

    • Docking studies with predicted interaction partners

  • Genomic context methods:

    • Gene neighborhood analysis across fungi

    • Phylogenetic profiling to identify co-evolving genes

    • Fusion protein detection

    • Gene expression correlation networks

    • Synteny analysis across yeast species

  • Integrative approaches:

    • Bayesian integration of multiple prediction methods

    • Machine learning classifiers trained on known protein functions

    • Network-based function prediction (GeneMANIA, STRING)

    • Literature-based discovery through text mining

    • Pathway completion approaches

  • Function prediction confidence assessment:

Prediction MethodConfidence ScorePredicted FunctionSupporting Evidence
Sequence homologyLow-MediumUnknownLimited sequence similarity to characterized proteins
Structural modelingMediumPotential binding functionPresence of pocket or cleft in predicted structure
Genomic contextMedium-HighResponse to cellular stressCo-expression with stress response genes
Network analysisMediumPotential role in protein quality controlPredicted interactions with chaperone system

These methodological approaches provide complementary perspectives on potential YDR290W functions, with confidence levels that guide experimental validation priorities.

How can researchers effectively integrate proteomics, transcriptomics, and metabolomics data in YDR290W studies?

Multi-omics integration provides a comprehensive understanding of YDR290W function:

  • Data generation considerations:

    • Experimental design for comparative omics

    • Use of YDR290W deletion strains versus controlled expression systems

    • Temporal sampling to capture dynamic responses

    • Condition selection based on preliminary phenotypic observations

    • Technical and biological replication requirements

  • Preprocessing and normalization approaches:

    • Platform-specific preprocessing workflows

    • Batch effect correction methods

    • Missing value imputation strategies

    • Standardization approaches across platforms

    • Quality control metrics for each data type

  • Individual omics analysis:

    • Proteomics: Differential abundance, post-translational modifications

    • Transcriptomics: Differential expression, co-expression networks

    • Metabolomics: Pathway enrichment, flux analysis

    • Phosphoproteomics: Kinase activity inference, signaling network reconstruction

  • Integration methodologies:

    • Correlation-based approaches across omics layers

    • Network integration methods (weighted correlation networks)

    • Pathway-based integration (KEGG, Reactome)

    • Machine learning approaches for pattern recognition

    • Causal modeling to infer regulatory relationships

  • Biological interpretation frameworks:

    • Enrichment analysis across multiple omics layers

    • Temporal sequencing of molecular events

    • Identification of regulatory hubs

    • Cross-validation of findings between omics platforms

    • Development of testable hypotheses for YDR290W function

  • Visualization strategies:

    • Multi-omics heatmaps and correlation networks

    • Pathway visualization with multi-omics overlay

    • Dimensionality reduction for integrated datasets (PCA, t-SNE)

    • Interactive visualization tools for data exploration

By systematically integrating multiple omics datasets, researchers can develop a comprehensive understanding of YDR290W's role in cellular processes, identify its position in regulatory networks, and generate specific hypotheses for experimental validation.

What are the critical parameters for successful preparation of S. cerevisiae ghost cells for YDR290W studies?

The preparation of S. cerevisiae ghost cells requires careful attention to methodology, especially when these ghost cells will be used for YDR290W research:

  • Chemical treatment optimization:

    • Determination of Minimum Inhibitory Concentrations (MIC) for each chemical agent

    • Sequential application of NaHCO₃, NaOH, SDS, and H₂O₂

    • Gentle agitation during treatment to ensure uniform exposure

    • Careful washing between treatments to remove previous agents

  • Critical parameters table:

ParameterOptimal ConditionCritical Considerations
Cell preparation1g dried yeast in 10ml solutionCell density affects chemical penetration
Chemical exposure time1 hour per chemicalShorter exposures insufficient, longer may damage structures
AgitationGentle shakingPrevents cell aggregation while minimizing structural damage
Separation methodDecantation rather than centrifugationPrevents cell collapse and self-adherence
Final preservation60% ethanol at 4°CMaintains structural integrity and prevents contamination
  • Quality assessment methods:

    • Light microscopy with crystal violet staining to evaluate 3D structure

    • Scanning electron microscopy for detailed surface morphology

    • DNA/protein quantification of supernatant to confirm cytoplasmic evacuation

    • Immunostaining to verify retention of surface proteins (including tagged YDR290W)

  • YDR290W-specific considerations:

    • For membrane-associated YDR290W studies, verification of protein retention during ghost preparation

    • Modified protocols for YDR290W-overexpressing strains

    • Comparison of ghost preparation from wild-type and YDR290W deletion strains

    • Assessment of cell wall integrity in ghost cells for YDR290W structural studies

  • Troubleshooting common issues:

    • Incomplete cytoplasmic evacuation: Adjust chemical concentration or exposure time

    • Structural collapse: Reduce mechanical stress during processing

    • Protein degradation: Modify protocol to include protease inhibitors

    • Inconsistent results: Standardize starting material and environmental conditions

These methodological considerations ensure the preparation of high-quality S. cerevisiae ghost cells suitable for advanced YDR290W studies, particularly those focused on cell envelope associations or structural roles.

What emerging technologies show promise for elucidating YDR290W function?

Several cutting-edge technologies offer new opportunities for understanding the function of uncharacterized proteins like YDR290W:

  • CRISPR-based functional genomics:

    • CRISPR interference (CRISPRi) for tunable repression

    • CRISPR activation (CRISPRa) for controlled overexpression

    • Base editors for generating point mutations without double-strand breaks

    • Prime editors for precise sequence alterations

    • Perturb-seq combining CRISPR perturbations with single-cell RNA-seq

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize YDR290W localization at nanoscale

    • Single-molecule tracking to monitor dynamics and interactions

    • Live-cell imaging with optogenetic control of YDR290W activity

    • Correlative light and electron microscopy for ultrastructural context

    • Cryo-electron tomography of YDR290W in cellular context

  • Protein structure determination advances:

    • AlphaFold2 and RoseTTAFold for accurate computational structure prediction

    • Cryo-EM for structure determination without crystallization

    • Integrative structural biology combining multiple experimental approaches

    • Cross-linking mass spectrometry for interaction interface mapping

    • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

  • Systems biology approaches:

    • Genome-scale metabolic modeling incorporating YDR290W constraints

    • Whole-cell modeling of S. cerevisiae including uncharacterized proteins

    • Multi-scale simulation from molecular to cellular levels

    • Network reconstruction with Bayesian approaches

    • Automated hypothesis generation and testing platforms

  • Synthetic biology strategies:

    • Minimal genome approaches to assess essentiality

    • Orthogonal expression systems for functional complementation

    • Designer protein scaffolds to probe potential functions

    • Cell-free systems to study YDR290W biochemistry

    • Engineered biosensors to detect YDR290W activity

These emerging technologies offer researchers powerful new tools to interrogate YDR290W function from multiple perspectives, potentially revealing roles that have remained elusive using conventional approaches.

How might comparative genomics across yeast species enhance our understanding of YDR290W?

Comparative genomics provides valuable evolutionary context for understanding YDR290W function:

  • Ortholog identification strategies:

    • Reciprocal BLAST searches across fungal genomes

    • Synteny-based ortholog detection

    • Phylogenetic tree construction for gene family analysis

    • OrthoMCL or OrthoFinder for automated ortholog grouping

    • Manual curation based on multiple sequence alignments

  • Evolutionary pattern analysis:

    • Sequence conservation profiling across orthologs

    • Selection pressure analysis (dN/dS ratios)

    • Identification of conserved residues and motifs

    • Lineage-specific adaptations or losses

    • Correlation with species-specific biological traits

  • Functional inference methodologies:

    • Phylogenetic profiling correlation with known pathways

    • Function prediction from characterized orthologs in other species

    • Co-evolution analysis with potential interaction partners

    • Conserved gene neighborhood analysis

    • Integration with phenotypic data across species

  • Experimental validation approaches:

    • Cross-species complementation experiments

    • Heterologous expression and localization studies

    • Comparison of deletion phenotypes across species

    • Chimeric protein analysis to identify functional domains

    • Reconstruction of ancestral sequences for functional testing

  • Data integration framework:

SpeciesYDR290W OrthologSequence IdentityConservation PatternKnown/Predicted Function
S. cerevisiaeYDR290W100%ReferenceUncharacterized
S. paradoxusOrtholog ID~90-95% (expected)Highly conservedSimilar to S. cerevisiae
S. bayanusOrtholog ID~80-85% (expected)Conserved coreSimilar to S. cerevisiae
Candida albicansOrtholog ID (if exists)~40-60% (expected)DivergentPotential specialization
Schizosaccharomyces pombeOrtholog ID (if exists)~30-50% (expected)Highly divergentPotentially different function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.