Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR355C (YDR355C)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Context

YDR355C is a gene in S. cerevisiae located on chromosome IV, designated as a “dubious open reading frame” (ORF) due to conflicting evidence about its coding potential . Key observations include:

  • Genomic Position: Partially overlaps the essential gene SPC110/YDR356W, which encodes a component of the spindle pole body .

  • Sequence Features: Predicted to encode a multi-pass membrane protein, though its sequence has been flagged as computationally uncertain .

  • Functional Ambiguity: Classified as a “product of a dubious gene prediction” with no experimentally validated function .

Dubious Coding Potential

Genomic and bioinformatic analyses suggest YDR355C is unlikely to encode a functional protein:

  • Overlap with Essential Genes: Partially overlaps SPC110, a critical gene for spindle pole body assembly .

  • Lack of Conservation: Not conserved across closely related Saccharomyces species, raising doubts about evolutionary significance .

  • Computational Red Flags: Classified as a “dubious” ORF in the S. cerevisiae Morphological Database (SCMD2) .

Hypothetical Roles

Despite its questionable status, some research suggests potential roles:

  • Membrane Localization: Predicted to span membranes, implying involvement in transport or signaling .

  • Experimental Utility: Used in ELISA kits for detecting anti-S. cerevisiae antibodies or as a control in protein interaction studies .

Applications in Research

While no direct functional studies on YDR355C exist, recombinant versions serve niche purposes:

  • Protein-Protein Interaction Studies: Used to test binding specificity in complex assays .

  • Diagnostic Tools: ELISA kits for detecting immune responses to S. cerevisiae proteins .

  • Structural Biology: Potential use in X-ray crystallography or cryo-EM studies (though no data exist) .

Key Challenges and Future Directions

  • Functional Validation: No experimental evidence confirms YDR355C’s role in S. cerevisiae biology.

  • Genomic Reannotation: Reevaluation of the S. cerevisiae genome may resolve its status as a pseudogene or artifact .

  • Research Gaps: Further studies are needed to determine its biological relevance or utility in model systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly contact your local distributor.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice packaging, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
YDR355C; Putative uncharacterized protein YDR355C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR355C
Target Protein Sequence
MLALISGKLSSNCEASLNSLVESIVSSMLLLCLFLTGPSFSSPLLAFGTLVGDTTCVCVV FRLDLINPTGVNSMFFKLPFGRCDASSMSVYQPFFALCGL
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR355C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the average expression level expected for uncharacterized proteins like YDR355C in S. cerevisiae?

Based on proteome-wide studies, the average protein concentration in S. cerevisiae is approximately 1 μM, with a typical range of 0.4-1.4 μM . For uncharacterized proteins, expression levels vary significantly depending on growth conditions and cellular state. When designing experiments to detect YDR355C, consider that an average yeast protein has approximately 12,100 copies per cell, though this number can vary substantially across the proteome . Expression levels are calculated based on copy number per cell, Avogadro's number, and the typical yeast cell volume of approximately 50μm³ (5×10⁻¹⁴ liter) .

Expression LevelTypical Copy NumberConcentration RangeRecommended Detection Methods
Very High>50,000>1.5 μMWestern blot, Standard MS
Medium-High10,000-50,0000.4-1.5 μMWestern blot, Standard MS
Low-Medium1,000-10,0000.04-0.4 μMTargeted MS, Fluorescence
Very Low<1,000<0.04 μMSRM/PRM MS, Enrichment

What experimental approaches should be prioritized for initial characterization of YDR355C?

For initial characterization of YDR355C, implement a multi-faceted approach beginning with:

  • Sequence analysis - Examine conservation patterns across fungal species

  • Structural prediction - Utilize AI-assisted tools like AlphaFold to predict protein structure

  • Localization studies - Employ GFP tagging to determine subcellular localization

  • Expression profiling - Analyze expression under various growth conditions

  • Phenotypic screening - Characterize deletion and overexpression strains

Recent advances in AI-assisted structural proteomics have revolutionized uncharacterized protein studies, allowing researchers to rapidly generate structural models that can inform functional hypotheses . These predictions can be validated using techniques such as crosslinking mass spectrometry, which captures proteins in their native cellular environment .

How should I design a recombinant expression system for studying YDR355C?

When designing a recombinant expression system for YDR355C, consider the following methodological framework:

  • Vector selection:

    • Integrative vectors for stable, single-copy expression

    • Centromeric vectors for moderate expression

    • 2μ-based vectors for high-copy expression

  • Promoter choice:

    • Constitutive promoters (TEF1, GPD) for consistent expression

    • Inducible promoters (GAL1, CUP1) for controlled expression

    • Native promoter to maintain physiological expression patterns

  • Tag selection:

    • Small epitope tags (HA, FLAG) for minimal interference

    • Fluorescent protein tags for localization studies

    • Affinity tags (His6, TAP) for purification

  • Expression verification:

    • Western blotting

    • Mass spectrometry

    • Microscopy for localization confirmation

Experimental design should account for the possibility that uncharacterized proteins may have condition-specific functions, suggesting the importance of testing expression and function under various growth conditions .

What are the most effective crosslinking mass spectrometry approaches for identifying interaction partners of YDR355C?

For identifying interaction partners of YDR355C, in-cell crosslinking mass spectrometry combined with cofractionation mass spectrometry (CoFrac-MS) represents one of the most effective approaches . This methodology allows for:

  • Capture of direct protein interactions in their native cellular environment

  • Detection of transient or weak interactions that might be lost during traditional immunoprecipitation

  • Generation of structural constraints that can inform computational modeling

The recommended workflow includes:

  • In vivo crosslinking of intact cells using membrane-permeable crosslinkers

  • Cell lysis under denaturing conditions

  • Enzymatic digestion of proteins

  • Enrichment of crosslinked peptides

  • LC-MS/MS analysis with specialized search algorithms

Research has demonstrated that crosslinking can stabilize labile protein interactions during purification. For example, RNA polymerase binders NusA and GreA were only found eluting with RNA polymerase when stabilized by crosslinking, while core subunits co-eluted regardless of crosslinking status .

How can AI-assisted structural prediction tools be integrated with experimental data to characterize YDR355C?

AI-assisted structural prediction tools can be powerfully integrated with experimental data through this methodological approach:

  • Generate initial structural models using AlphaFold or similar tools

  • Validate and refine these models using experimental constraints from:

    • Crosslinking mass spectrometry data

    • Limited proteolysis

    • Hydrogen-deuterium exchange

  • Use the refined models to predict:

    • Protein-protein interaction interfaces

    • Potential binding sites

    • Functional domains

  • Design targeted experiments to test structure-based hypotheses:

    • Site-directed mutagenesis of predicted functional residues

    • Construction of predicted binary and higher-order complexes

For complex prediction, the interface predicted TM-score (ipTM) serves as a valuable confidence metric, with values above 0.85 indicating high-quality structural models . Recent research has demonstrated the power of combining complementary techniques including in-cell crosslinking to discover high-confidence direct protein interactions without genetic modification .

What experimental design considerations are crucial when using synthetic recombinant populations to study YDR355C?

When designing experiments using synthetic recombinant populations to study YDR355C, several methodological considerations are critical:

  • Founder selection strategy:

    • The number of founder strains (4, 8, or 12) significantly impacts genetic diversity

    • Selection of strains with diverse phenotypes relevant to the hypothesized function

    • Consideration of natural variation in YDR355C across strains

  • Crossing design:

    • "Funnel" approach (progressively combining strains) versus "round-robin" (all-by-all crossing)

    • Number of recombination rounds to achieve desired mapping resolution

    • Population size maintenance to prevent genetic bottlenecks

  • Selection regime:

    • Conditions relevant to hypothesized YDR355C function

    • Temporal sampling strategy to capture evolutionary trajectories

    • Controls to account for adaptation unrelated to YDR355C

Research has shown that different crossing approaches produce populations with distinct patterns of genetic variation, with the more labor-intensive "round-robin" approach potentially offering advantages in terms of equal founder haplotype representation and higher levels of genetic variation .

How can I address the challenge of low expression levels when studying YDR355C?

When facing potential low expression levels of YDR355C, implement this methodological approach:

  • Optimize detection sensitivity:

    • Employ targeted mass spectrometry approaches (SRM/PRM) capable of detecting proteins at concentrations below 0.1μM

    • Use high-sensitivity Western blotting with enhanced chemiluminescence

    • Apply single-molecule fluorescence techniques for localization studies

  • Enhance expression:

    • Test expression under various growth conditions and stresses

    • Utilize strong inducible promoter systems

    • Consider codon optimization while maintaining protein folding

    • Evaluate expression timing throughout growth phases

  • Employ enrichment strategies:

    • Implement affinity purification with appropriate tags

    • Use subcellular fractionation to concentrate compartment-specific proteins

    • Apply protein concentration techniques compatible with downstream applications

  • Consider alternatives:

    • Heterologous expression in alternative hosts

    • Cell-free protein expression systems

    • Synthetic peptide generation for antibody production

For proteins with particularly low abundance (below 100 copies per cell), specialized approaches combining enrichment with highly sensitive detection methods may be necessary .

What are the recommended approaches for distinguishing between direct and indirect protein interactions involving YDR355C?

To distinguish between direct and indirect protein interactions involving YDR355C, employ this systematic approach:

  • Apply proximity-dependent techniques:

    • Crosslinking mass spectrometry using short-range crosslinkers (<10Å)

    • Site-specific photocrosslinking with genetically encoded photo-activatable amino acids

    • Zero-length crosslinking methods (e.g., EDC chemistry)

  • Perform binary interaction assays:

    • In vitro pull-down assays with purified components

    • Surface plasmon resonance with isolated proteins

    • Yeast two-hybrid with stringent controls

  • Validate interactions structurally:

    • Integrate crosslinking data with computational modeling

    • Predict interaction interfaces using AI-assisted structural models

    • Test interfaces by mutagenesis of predicted contact residues

Research has demonstrated that combining in-cell crosslinking with size exclusion chromatography can reveal interactions that might be missed by either technique alone . For example, studies have identified novel heterodimeric complexes between paralogs that were previously only known to form homomeric assemblies .

What phenotypic assays are most informative when studying deletion or overexpression of YDR355C?

When characterizing the phenotypic effects of YDR355C deletion or overexpression, implement this comprehensive testing framework:

  • Growth-based assays:

    • Growth curve analysis in various media compositions

    • Stress response testing (oxidative, osmotic, temperature, pH)

    • Carbon source utilization profiling

    • Chemical genetic screening against diverse compounds

  • Cellular and molecular phenotyping:

    • Microscopic analysis of cell morphology and organization

    • Transcriptomic profiling to identify affected pathways

    • Metabolomic analysis to detect biochemical alterations

    • Phosphoproteomic analysis to identify signaling changes

  • Functional genomics approaches:

    • Synthetic genetic array analysis to identify genetic interactions

    • Multicopy suppressor screening

    • High-throughput phenotyping across hundreds of conditions

    • Comparative analysis across genetic backgrounds

When designing these assays, consider that uncharacterized proteins often have condition-specific functions or subtle phenotypic effects that may only be apparent under specific conditions . Recent research on previously uncharacterized proteins demonstrates how integrating multiple phenotypic approaches can successfully identify novel protein functions, as exemplified by the identification of YneR (renamed PdhI) as an inhibitor of pyruvate dehydrogenase .

How can I integrate evolutionary conservation analysis to predict potential functions of YDR355C?

To leverage evolutionary conservation for functional prediction of YDR355C, implement this methodological framework:

  • Sequence-based evolutionary analysis:

    • Identify orthologs across fungal species using reciprocal BLAST

    • Calculate site-specific evolutionary rates using rate4site or similar tools

    • Identify conserved motifs and potential functional sites

    • Analyze coevolution patterns with putative interaction partners

  • Structure-based conservation mapping:

    • Project conservation scores onto predicted 3D structures

    • Identify surface patches with high conservation (potential interaction sites)

    • Compare with structures of characterized proteins

    • Analyze conservation patterns in predicted binding pockets

  • Comparative genomics approaches:

    • Analyze gene neighborhood conservation across species

    • Perform phylogenetic profiling to identify co-evolving genes

    • Examine expression pattern conservation across species

    • Investigate potential horizontal gene transfer events

  • Functional validation:

    • Test cross-species complementation with orthologs

    • Evaluate the impact of mutations in highly conserved residues

    • Compare phenotypic effects with those of characterized orthologs

This multi-layered approach helps distinguish between functionally critical regions and structural constraints, providing insights into the potential biological roles of YDR355C.

What considerations are important when designing site-directed mutagenesis experiments for YDR355C?

When designing site-directed mutagenesis experiments for YDR355C, follow this methodological approach:

  • Target selection strategy:

    • Prioritize highly conserved residues identified through evolutionary analysis

    • Focus on predicted functional sites from structural models

    • Target residues in predicted protein-protein interfaces

    • Consider potential post-translational modification sites

  • Mutation design principles:

    • Conservative substitutions to test specific chemical properties

    • Radical substitutions to disrupt function

    • Alanine scanning of defined regions

    • Introduce specific biophysical probes

  • Validation approach:

    • Verify protein expression and stability post-mutation

    • Assess structural integrity using techniques like thermal shift assays

    • Quantify effects on protein-protein interactions

    • Measure functional consequences through relevant phenotypic assays

  • Experimental controls:

    • Include mutations in non-conserved surface residues as negative controls

    • Create revertant mutants to confirm phenotype specificity

    • Benchmark effects against wild-type protein under identical conditions

This systematic approach allows for rigorous testing of structure-function hypotheses derived from computational predictions and evolutionary analysis.

How can I determine if YDR355C functions as part of a protein complex?

To determine if YDR355C functions as part of a protein complex, employ this systematic methodological workflow:

  • Physical interaction mapping:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Crosslinking mass spectrometry to capture transient interactions

    • Size exclusion chromatography with and without crosslinking

    • Blue native PAGE to preserve native complexes

  • Structural characterization:

    • Predict complex structures using AI-assisted modeling

    • Validate predicted interfaces using crosslinking constraints

    • Consider multiple possible stoichiometries and configurations

    • Test interface mutations to disrupt complex formation

  • Functional validation:

    • Assess co-localization in vivo

    • Test coordinated expression across conditions

    • Evaluate phenotypic consequences of disrupting interactions

    • Compare with known complex members in related pathways

Recent research has demonstrated that crosslinking can stabilize protein complex members during purification, allowing for detection of interactions that might be missed by traditional approaches . When predicting complex structures, evaluating both high and low-scoring predictions is important, as demonstrated in studies where crosslinks were only satisfied in the worse-scoring trimer conformation .

What are the key experimental design principles to ensure reliable results when studying YDR355C?

When designing experiments to study YDR355C, implement these key methodological principles:

  • Control selection and implementation:

    • Include appropriate positive and negative controls

    • Use empty vector controls for expression studies

    • Implement wild-type strain controls for deletion/mutation studies

    • Consider isogenic strain backgrounds to minimize confounding genetic variation

  • Variable isolation:

    • Manipulate the explanatory variable (e.g., YDR355C expression) while controlling other variables

    • Identify and address potential lurking variables that could confound results

    • Use randomization to distribute uncontrolled variables equally

  • Replication strategy:

    • Perform biological replicates (independent cultures/transformations)

    • Include technical replicates to assess measurement variability

    • Calculate appropriate sample sizes based on expected effect magnitude

    • Consider replications across different strain backgrounds

  • Validation approach:

    • Confirm findings using orthogonal methods

    • Test across multiple environmental conditions

    • Validate key findings in independent laboratories

    • Consider publication of negative results to combat publication bias

Proper experimental design ensures the production of reliable, accurate data by controlling for confounding factors and minimizing systematic errors .

How should I approach contradictory results when characterizing YDR355C?

When facing contradictory results in YDR355C characterization, implement this resolution methodology:

  • Systematic validation:

    • Verify reagent quality (plasmids, antibodies, strain identity)

    • Confirm protein expression and localization

    • Check for experimental artifacts and technical limitations

    • Ensure appropriate controls were implemented

  • Condition-dependent analysis:

    • Test under various growth conditions and stresses

    • Examine cell-cycle dependence

    • Consider post-translational modifications

    • Evaluate strain background effects

  • Methodological cross-validation:

    • Apply orthogonal techniques to the same question

    • Compare in vivo, in vitro, and in silico approaches

    • Assess method-specific limitations and biases

    • Implement more sensitive or specific methods

  • Collaborative resolution:

    • Engage with researchers using different methodologies

    • Consider blind testing protocols

    • Implement standardized protocols across laboratories

    • Design decisive experiments to specifically address contradictions

Recent research demonstrates that combining complementary techniques can resolve apparent contradictions. For instance, studies have shown that certain protein interactions are only detectable when stabilized by crosslinking , explaining why they might be missed in traditional co-immunoprecipitation experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.