Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR396W (YDR396W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your application.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
YDR396W; Putative uncharacterized protein YDR396W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR396W
Target Protein Sequence
MHALNIFPCGLFSYIALLCLEASIQEESSDLTGSDTLLWCNLDLDCLNNSSCCRSSSSSE RPDFLNLESLVSFTFWEPLKFNNISSKNGINSLYSNSSSALITCSGAMVFLASLSAISEA IEDRIIMNSMPELMMISLASLVNIKSWSSISDIIFCTVAKIIQCFL
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR396W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YDR396W and why is it classified as a putative uncharacterized protein?

YDR396W is classified as a putative uncharacterized protein from Saccharomyces cerevisiae (baker's yeast). It is considered a "dubious open reading frame unlikely to encode a functional protein" that "extensively overlaps essential NCB2 gene encoding the beta subunit of the NC2 dimeric histone-fold complex" . This classification reflects uncertainty about its functional significance, despite its presence in the yeast genome. The protein consists of 166 amino acids , and while it has been included in various systematic studies, its specific cellular functions remain largely undetermined.

What expression systems are available for studying recombinant YDR396W?

Recombinant YDR396W protein has been successfully expressed in E. coli expression systems with histidine tags for purification purposes. Commercial suppliers offer recombinant full-length Saccharomyces cerevisiae putative uncharacterized protein YDR396W with His-tags . The typical expression construct includes:

Cat.#Product nameSource (Host)SpeciesTagProtein Length
RFL201SFRecombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ydr396W (Ydr396W) ProteinE.coliS.cerevisiaeHisFull Length (1-166)

For researchers planning expression studies, E. coli remains the primary expression system due to its ease of use and established protocols for yeast protein expression.

What antibodies and detection methods are available for YDR396W research?

Polyclonal antibodies against YDR396W are commercially available for research applications. These antibodies are typically produced in rabbits using recombinant Saccharomyces cerevisiae (strain ATCC 204508/S288c) YDR396W protein as the immunogen . Available antibodies have been validated for applications including:

  • Western blotting (WB)

  • Enzyme-linked immunosorbent assay (ELISA)

The antibodies are typically provided in liquid form with the following specifications:

  • Storage buffer: Preservative (0.03% Proclin 300) with 50% Glycerol, 0.01M PBS, pH 7.4

  • Purification method: Antigen Affinity Purified

  • Isotype: IgG

  • Storage recommendations: -20°C or -80°C, avoiding repeated freeze-thaw cycles

What is currently known about YDR396W's potential functions?

Despite being classified as a dubious ORF, YDR396W has been implicated in several cellular processes through high-throughput studies:

  • uORF-mediated regulation: YDR396W contains strong repressor uORFs that can modulate gene expression. Experimental manipulation of its UTR length has demonstrated that the YDR396W uORF becomes less repressive when the 5' UTR is extended .

  • Protein interactions: String database analysis indicates potential functional associations with several proteins involved in important cellular processes:

    • UTP5: U3 small nucleolar RNA-associated protein involved in 18S rRNA production

    • NOC4: Nucleolar protein mediating maturation of 40S ribosomal subunits

    • SUA5: Threonylcarbamoyl-AMP synthase involved in RNA t6A modification

    • KAE1: tRNA N6-adenosine threonylcarbamoyltransferase component of the EKC/KEOPS complex

  • Telomere length influence: YDR396W has been identified in genome-wide screens for genes affecting telomere length in yeast .

How does YDR396W relate to the overlapping NCB2 gene?

YDR396W extensively overlaps with the essential NCB2 gene, which encodes the beta subunit of the NC2 dimeric histone-fold complex . This genomic arrangement creates challenges for functional studies as phenotypes attributed to YDR396W mutations might actually result from effects on NCB2 expression.

Methodological approaches to distinguish YDR396W effects from NCB2 effects include:

  • Precise genetic manipulations that alter YDR396W sequence without affecting NCB2

  • Complementation studies with NCB2 expression constructs

  • Conditional expression systems to control NCB2 expression while studying YDR396W

What experimental designs are most effective for studying putative proteins like YDR396W?

When investigating putative uncharacterized proteins like YDR396W, several experimental design approaches can be particularly effective:

  • Block randomized design: This approach involves collecting pre-treatment covariates expected to correlate with outcomes, which can decrease standard error in experimental results . For YDR396W studies, this might involve blocking based on strain background or expression levels.

  • Pre-post designs: These designs measure outcomes before and after experimental manipulation, reducing variance in potential outcomes and increasing precision . For YDR396W, this could involve measuring cellular parameters before and after protein induction or depletion.

  • True experimental designs with control groups: The most rigorous approach involves randomly assigning subjects to experimental and control groups with deliberate manipulation of independent variables . For YDR396W research, this would typically involve:

    • Control group: Wild-type yeast or cells with unaltered YDR396W

    • Experimental group: Cells with mutations, deletions, or overexpression of YDR396W

    • Systematic variable manipulation: Altering growth conditions, genetic background, or interacting factors

For investigating YDR396W specifically, the experimental design should account for its overlapping nature with NCB2 to avoid confounding effects.

How should researchers approach contradictions in YDR396W experimental data?

Data contradictions, while potentially confusing, can provide valuable insights when properly analyzed. For YDR396W, researchers should:

  • Adopt a data-agnostic mindset: Acknowledge that all data is imperfect and use multiple sources to build a comprehensive understanding .

  • Apply structured contradiction analysis: Consider using a notation system for contradiction patterns that reflects the interdependencies in the data. This can be represented as parameters (α, β, θ), where:

    • α represents the number of interdependent items

    • β represents the number of contradictory dependencies

    • θ represents the minimal number of Boolean rules needed to assess these contradictions

  • Embrace rather than dismiss contradictions: Contradictions in YDR396W data might reflect biological reality rather than experimental error. For example, contradictory effects on gene expression might indicate context-dependent functions .

  • Document experimental conditions thoroughly: Since YDR396W function may be condition-dependent, detailed documentation of strain backgrounds, growth conditions, and experimental parameters is essential for resolving apparent contradictions.

What genomic and computational approaches are useful for predicting YDR396W function?

Several computational approaches can help predict potential functions of YDR396W:

  • The Z-curve protein-coding gene-finding algorithm: This approach has achieved >95% accuracy in identifying protein-coding genes in the yeast genome and could be applied to analyze the coding potential of YDR396W . The algorithm uses the YZ score:

YZ = [F(u) - F min]/[F max+ - F min-] × 100

Where F(u) = c·uc0, with c representing the coefficients derived from a training set and u representing the normalized phase-specific nucleotide frequencies.

  • Functional partner prediction: Tools like STRING database can identify potential functional partners based on:

    • Neighborhood evidence

    • Gene fusion evidence

    • Cooccurrence patterns

    • Coexpression data

    • Experimental evidence

    • Database annotations

    • Text mining results

  • Evolutionary conservation analysis: Comparing YDR396W sequences across related yeast species can identify conserved elements that might indicate functional importance.

How can uORF-based research methodologies be applied to YDR396W studies?

YDR396W contains strong repressor uORFs that have been studied in the context of gene regulation. Key methodologies for investigating these uORFs include:

What methods are recommended for investigating YDR396W's potential role in telomere length regulation?

YDR396W has been identified in genome-wide screens for genes affecting telomere length. To investigate this connection further, researchers should consider:

  • Telomeric Southern blot analysis: This technique has been successfully used to analyze telomere length in yeast mutants. For reliable results, researchers should:

    • Grow at least three individual colonies of each strain

    • Include wild-type isogenic strain triplicates as controls

    • Include marker PCR fragments as internal standards

    • Confirm strain identity through PCR analysis and tetrad analysis

  • Integration with other telomere-related mutants: YDR396W studies should consider its relationship with the EKC/KEOPS complex (including Kae1p, Bud32p, Cgi121p, Pcc1p, and Gon7p), which is required for telomeric TG1-3 recombination .

  • Co-segregation analysis: To confirm phenotype-genotype relationships, researchers should analyze co-segregation between telomere length and resistance markers (such as G418 resistance) conferred by the mutation .

What are promising areas for future YDR396W research?

Based on current knowledge, several promising research directions for YDR396W include:

  • Regulatory RNA function: Given its strong uORF repressor activity, YDR396W might function primarily at the RNA level rather than as a protein.

  • Interaction with the NCB2 histone-fold complex: Investigating how YDR396W's transcription or translation might affect the overlapping NCB2 gene could reveal regulatory mechanisms.

  • Role in stress response pathways: Many dubious ORFs become functionally relevant under specific stress conditions, suggesting stress response studies might reveal YDR396W functions.

  • Involvement in ribosome biogenesis: The interaction network of YDR396W includes multiple proteins involved in ribosome biogenesis and RNA processing, suggesting potential roles in these processes.

How should researchers approach the contradictory classification of YDR396W as a dubious ORF versus its implications in cellular processes?

The contradictory nature of YDR396W - classified as dubious yet implicated in multiple processes - represents a valuable research opportunity that should be approached by:

This approach recognizes that contradictions in biological data often lead to the most significant scientific advances, particularly for challenging biological entities like putative uncharacterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.