Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR401W (YDR401W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YDR401W; Putative uncharacterized protein YDR401W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR401W
Target Protein Sequence
MFYIYSIIFSLNFNFKLRGQRGPAGVNFSSHSGSRLHRNCFNISAKEILISVRASFSPRH ALRPPWNPVTAHLFFAILQFFLMVSISEPHLSGLKSSAVVPQVLGSCEVPKLLYPTYTPL GITISAPNLHVLVVHLLIIVLKGGYILTTSKRKAFNKGKSAKPFGSVMPFTSFLSFSCHS FEYLARR
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR401W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How can researchers obtain and handle recombinant YDR401W protein?

Recombinant YDR401W protein is available as a lyophilized powder with an N-terminal His-tag . Methodological approach for handling:

  • Reconstitution process:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (recommended: 50%)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Quality assessment:

    • Verify protein purity (>90% by SDS-PAGE)

    • Confirm identity via mass spectrometry or immunoblotting with anti-His antibodies

What experimental systems can be used to study YDR401W in vivo?

Several experimental systems can be employed to study YDR401W in its native context:

  • Gene deletion approaches:

    • Replace the open reading frame (ORF) with a deletion cassette (e.g., KanMX4) using the short flanking homology (SFH) method

    • Transform yeast using the lithium acetate method

    • Select transformants based on geneticin resistance

    • Confirm successful deletion by PCR verification

  • Growth condition optimization:

    • Initial propagation in yeast extract peptone dextrose (YPD) medium containing 20 g/L glucose, 20 g/L peptone, and 10 g/L yeast extract

    • Transfer to synthetic media with defined nitrogen sources (e.g., SD media with 230.8 mg/L NH₄Cl corresponding to 60 mg/L YAN)

    • For selective media, use YPD with 200 mg/L G418 disulphate salt

  • Continuous culture systems:

    • Utilize bioreactors with controlled parameters (temperature 28°C, pH 3.3, 300 rpm stirring)

    • Set dilution rate at 0.2 h⁻¹ corresponding to exponential growth phase

    • Control pH using automatic addition of 2 M NaOH

    • Inoculate with 2×10⁶ cells/mL

What bioinformatic approaches can predict potential functions of YDR401W?

Given that YDR401W is uncharacterized, bioinformatic approaches are crucial for generating functional hypotheses:

  • Z-curve methodology:
    The Z-curve method has demonstrated >95% accuracy in identifying protein-coding genes in the yeast genome and can be applied to analyze YDR401W . The approach involves:

    • Calculating the Z-curve parameters based on the distribution of bases

    • Computing the YZ score using the formula:
      YZ=F(u)FminFmax+Fmin\text{YZ} = \frac{F(\mathbf{u}) - F_{\min-}}{F_{\max+} - F_{\min-}}

    • Using the decision criterion: YZ > 0.5 indicates coding regions

  • Protein structure prediction:

    • Generate 3D structural models using AlphaFold or similar tools

    • Analyze predicted structural motifs for functional insights

    • Compare with known structures using structural alignment algorithms

  • Sequence-based analyses:

    • Perform BLAST searches against fungal genomes to identify orthologs

    • Conduct multiple sequence alignments to identify conserved residues

    • Apply domain prediction algorithms to identify functional domains

What experimental designs are most effective for characterizing uncharacterized proteins like YDR401W?

Effective experimental design for characterizing unknown proteins requires a systematic approach with proper controls:

  • True experimental design principles:

    • Establish control groups vs. experimental groups with random assignment

    • Ensure proper variable manipulation to observe effects on dependent variables

    • Implement random distribution of variables to control for extraneous factors

  • Comprehensive characterization strategy:

    • Stage 1: Preliminary bioinformatic analysis to generate hypotheses

    • Stage 2: Phenotypic analysis of deletion mutants under various conditions

    • Stage 3: Protein localization studies

    • Stage 4: Interaction partner identification

    • Stage 5: Biochemical function analysis

  • Phenotypic analysis methodology:

    • Create deletion strains using the KanMX4 cassette

    • Test growth under various stress conditions (temperature, pH, osmotic)

    • Analyze cellular morphology and organelle distribution

    • Measure specific metabolic parameters relevant to predicted function

Experimental PhaseMethodsControlsExpected Outcomes
Deletion Strain CreationPCR-based gene replacementWild-type strain, unrelated gene deletionVerified YDR401W deletion
Phenotypic ScreeningGrowth assays, microscopyWild-type in identical conditionsIdentification of conditions where YDR401W is important
Localization StudiesGFP-tagging, fluorescence microscopyKnown localization markersSubcellular compartment identification
Interaction StudiesCo-IP, Y2H, MSNon-specific binding controlsIdentification of protein partners

How can CRISPR-Cas9 technology be optimized for studying YDR401W?

CRISPR-Cas9 offers powerful approaches for studying YDR401W with high precision:

  • Guide RNA design considerations:

    • Design sgRNAs targeting specific regions of YDR401W

    • Prioritize guides with minimal off-target effects

    • Consider GC content and secondary structure for optimal efficiency

    • Use yeast-optimized Cas9 and sgRNA expression systems

  • Modification strategies:

    • Complete knockout: Replace entire ORF with selectable marker

    • Domain disruption: Target specific functional domains

    • Tagging approach: Introduce fluorescent or epitope tags for visualization and purification

    • Point mutations: Create specific amino acid substitutions to test structure-function relationships

  • Validation methodology:

    • Confirm edits by sequencing

    • Analyze expression using RT-qPCR

    • Verify protein modification/absence by Western blotting

    • Assess phenotypic consequences compared to wild-type controls

What methods are most effective for detecting protein-protein interactions involving YDR401W?

Understanding the interaction network of YDR401W can provide significant functional insights:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express His-tagged YDR401W in S. cerevisiae

    • Perform affinity purification under native conditions

    • Identify co-purified proteins by mass spectrometry

    • Filter against common contaminants and perform statistical analysis

  • Yeast two-hybrid screening:

    • Create bait constructs with YDR401W fused to DNA-binding domain

    • Screen against prey libraries of S. cerevisiae ORFs

    • Validate positive interactions with secondary assays

    • Map interaction domains through truncation analysis

  • In vivo proximity labeling:

    • Fuse YDR401W to BioID or TurboID

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins with streptavidin

    • Identify by mass spectrometry

  • Split-reporter systems:

    • Create YDR401W fusions with split fluorescent proteins

    • Co-express with candidate interactors

    • Analyze reconstitution of fluorescence signal

    • Quantify interaction strength through fluorescence intensity

How can researchers resolve conflicting data when studying uncharacterized proteins like YDR401W?

When studying uncharacterized proteins, conflicting results are common and require systematic resolution approaches:

  • Methodological validation:

    • Verify reagent quality and specificity (antibodies, expression constructs)

    • Repeat experiments with alternative techniques

    • Implement additional controls to rule out artifacts

    • Consider strain background effects on phenotypes

  • Data integration framework:

    • Prioritize direct biochemical evidence over computational predictions

    • Consider the strength of different experimental approaches

    • Integrate data from multiple techniques into a consensus model

    • Identify conditions that might explain apparent contradictions

  • Hypothesis refinement process:

    • Formulate testable hypotheses to explain conflicting results

    • Design critical experiments to distinguish between competing models

    • Apply statistical methods to determine significance of differences

    • Consider whether YDR401W might have context-dependent functions

  • Collaborative verification:

    • Establish collaborations with labs using complementary approaches

    • Perform blind replication studies

    • Share reagents and protocols to ensure consistency

    • Consider publishing contradictory findings to advance field knowledge

What is the optimal protocol for expressing recombinant YDR401W in heterologous systems?

Based on established methodologies, the following protocol optimizes recombinant YDR401W expression:

  • Expression system selection:

    • E. coli BL21(DE3) or derivatives have been successfully used

    • For complex folding requirements, consider Pichia pastoris or insect cell systems

  • Construct design optimization:

    • Include N-terminal His-tag for purification

    • Consider codon optimization for the expression host

    • Include a cleavable linker if tag removal is needed

    • Verify construct by sequencing

  • Expression conditions:

    • Test multiple temperatures (16°C, 25°C, 37°C)

    • Optimize induction parameters (IPTG concentration, induction timing)

    • Screen different media formulations

    • Monitor expression by SDS-PAGE and Western blotting

  • Purification workflow:

    • Lyse cells under conditions maintaining protein solubility

    • Perform initial capture using Ni-NTA affinity chromatography

    • Add secondary purification steps as needed (ion exchange, size exclusion)

    • Validate final purity (>90% by SDS-PAGE)

What analytical techniques are most suitable for studying the structure-function relationship of YDR401W?

Understanding structure-function relationships requires a multi-technique approach:

  • Spectroscopic methods:

    • Circular dichroism (CD) for secondary structure determination

    • Fluorescence spectroscopy for tertiary structure and ligand binding

    • NMR for residue-level structural information

    • Thermal shift assays to identify stabilizing conditions

  • Biophysical characterization:

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) for oligomeric state

    • Analytical ultracentrifugation for hydrodynamic properties

    • Small-angle X-ray scattering (SAXS) for solution structure

    • Crystallization trials for high-resolution structure determination

  • Functional mapping approach:

    • Generate site-directed mutants of conserved residues

    • Create domain deletion variants

    • Test functional consequences of each mutation

    • Correlate structural features with functional outcomes

  • Computational analysis:

    • Molecular dynamics simulations to explore conformational flexibility

    • Docking studies to predict potential ligand binding sites

    • Quantum mechanics calculations for catalytic mechanism prediction

How can researchers design genetic screens to identify the function of YDR401W?

Systematic genetic screens can reveal functional relationships:

  • Synthetic genetic array (SGA) methodology:

    • Cross YDR401W deletion strain with genome-wide deletion collection

    • Score genetic interactions based on colony growth

    • Identify synthetic lethal or synthetic sick interactions

    • Map YDR401W to specific cellular pathways based on interaction profiles

  • Suppressor screen design:

    • If YDR401W deletion causes a phenotype, screen for suppressors

    • Transform deletion strain with genomic or cDNA libraries

    • Select for restoration of wild-type phenotype

    • Identify and validate suppressor genes

  • Chemical-genetic profiling:

    • Test sensitivity/resistance of YDR401W deletion to compound libraries

    • Compare chemical-genetic profile with other deletion strains

    • Identify compounds specifically affecting YDR401W mutants

    • Use chemical probes to infer protein function

  • Reporter system development:

    • Create reporter constructs based on predicted function

    • Test activation/repression in presence/absence of YDR401W

    • Optimize signal-to-noise ratio through control experiments

    • Validate with independent measurement techniques

How can transcriptomic approaches be used to understand the biological context of YDR401W?

Transcriptomic analyses provide insights into gene expression networks involving YDR401W:

  • RNA-Seq experimental design:

    • Compare wild-type vs. YDR401W deletion strains

    • Include multiple biological replicates (n≥3)

    • Test different environmental conditions relevant to predicted function

    • Implement strict quality control for RNA isolation and library preparation

  • Data analysis pipeline:

    • Perform quality filtering and adapter trimming

    • Map reads to S. cerevisiae reference genome

    • Quantify gene expression levels

    • Identify differentially expressed genes

    • Conduct GO enrichment and pathway analysis

  • Network analysis approach:

    • Construct co-expression networks

    • Identify modules containing YDR401W

    • Analyze transcription factor binding sites

    • Integrate with protein-protein interaction data

  • Validation strategy:

    • Confirm key findings with RT-qPCR

    • Test protein-level changes with proteomics

    • Perform ChIP-seq for relevant transcription factors

    • Correlate with phenotypic observations

What methods can determine if YDR401W is a genuine protein-coding gene?

Confirming YDR401W as a genuine protein-coding gene requires multiple lines of evidence:

  • Z-curve methodology application:

    • Calculate Z-curve parameters for YDR401W

    • Apply the YZ score formula with threshold of YZ > 0.5 indicating coding regions

    • Compare results with known coding and non-coding regions

  • Transcriptional evidence:

    • Perform strand-specific RNA-Seq

    • Analyze ribosome profiling data

    • Map transcription start sites with CAGE analysis

    • Determine if transcription patterns are consistent with annotation

  • Translational evidence:

    • Use mass spectrometry to detect peptides from YDR401W

    • Perform N-terminal sequencing to confirm translation start site

    • Analyze ribosome occupancy with ribosome profiling

    • Express epitope-tagged versions to confirm translation

  • Evolutionary analysis:

    • Examine codon usage bias patterns

    • Calculate Ka/Ks ratios across related yeast species

    • Analyze conservation patterns expected for coding sequences

    • Compare with known pseudogenes and non-coding RNAs

How can researchers determine the optimal conditions for studying YDR401W function in vivo?

Optimizing experimental conditions is crucial for revealing YDR401W function:

  • Growth condition screening:

    • Test various carbon sources (glucose, galactose, glycerol)

    • Vary nitrogen availability using defined media with specific YAN concentrations

    • Challenge with different stress conditions (temperature, pH, osmotic)

    • Examine different growth phases (lag, exponential, stationary)

  • Continuous culture optimization:

    • Implement chemostat cultures with defined parameters

    • Control temperature (28°C), pH (3.3), and stirring (300 rpm)

    • Set dilution rate (D) at 0.2 h⁻¹ for exponential phase studies

    • Maintain cell density at approximately 2×10⁶ cells/mL

  • Induction/repression optimization:

    • If YDR401W is under conditional regulation, determine optimal induction conditions

    • Design reporter constructs to monitor expression levels

    • Test different promoter systems for controlled expression

    • Monitor protein levels under various conditions

  • Phenotypic assay development:

    • Design specific assays based on predicted function

    • Optimize detection sensitivity and dynamic range

    • Include appropriate controls for each condition

    • Ensure reproducibility across biological replicates

What statistical approaches are most appropriate for analyzing experimental data related to YDR401W?

By applying these methodological approaches, researchers can systematically investigate the uncharacterized protein YDR401W and contribute to understanding its biological role in Saccharomyces cerevisiae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.