Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR413C (YDR413C)

Shipped with Ice Packs
In Stock

Description

Functional Predictions

Despite its uncharacterized status, integrative studies provide clues about its potential roles:

Nucleic Acid Metabolism

  • Copurification with metallohydrolase/oxidoreductase homologs suggests involvement in DNA repair or RNA catabolism .

  • Localization data indicate interactions with mitochondrial (Nuc1) and nuclear (YMR099c) complexes linked to RNA processing .

Membrane Association

  • Predicted transmembrane topology implies a role in membrane transport or signaling .

Homology Insights

  • Remote sequence homology to ELAC2, a human tRNA-processing endonuclease, hints at conserved ribonuclease activity .

Recombinant Production and Applications

Recombinant YDR413C is commercially available for experimental use:

Expression Systems

  • Produced in E. coli, yeast, or mammalian cells with N-/C-terminal tags for stability .

  • Available in lyophilized or liquid formats .

Research Applications

ApplicationExperimental DetailsSource
Antibody developmentRabbit polyclonal antibodies validated for ELISA and Western blot (S. cerevisiae)
Protein interactionUsed in yeast two-hybrid screens to identify binding partners
Structural studiesPurified for crystallization trials (no published structures to date)

Limitations and Controversies

  • Functional ambiguity: Annotations rely on computational predictions (e.g., PSI-BLAST, fold recognition) rather than direct experimental validation .

  • Gene overlap: Partial overlap with neighboring gene YDR412W complicates functional studies .

Future Directions

  • Crispr/Cas9 knockouts to assess phenotypic impacts in S. cerevisiae.

  • Structural biology efforts to resolve its 3D conformation and active sites.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your preference.
Synonyms
YDR413C; Putative uncharacterized protein YDR413C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR413C
Target Protein Sequence
MRLHYLLRLLSFAFLWFILRSFLVKYLNFFTLGFFFCFSSTPRNFAYLVALFMLCLSTFS AFSNLTLFSWAKYSKLSLGSNVSNSTVVESSYISVIAPFFKIGFTLLSLLSLSPSSLSES NPCQDSSDSTCKSSVLSFFASSISASKFKLSLNVFNCSSITSLRSCRIFCLSSIFLSLSC SLINSCAFFCL
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the fundamental characteristics of YDR413C protein?

YDR413C is a putative uncharacterized protein from Saccharomyces cerevisiae with a full-length sequence of 191 amino acids. It is available as a recombinant protein expressed in E. coli systems with histidine tagging to facilitate purification and downstream applications . The protein is part of the Saccharomyces Genome Database (SGD), which provides the reference genome sequence derived from laboratory strain S288C .

To characterize this protein effectively, researchers should begin with sequence analysis using standard bioinformatics tools including BLASTN, BLASTP, and six-frame translation available through SGD. These analyses can provide insights into sequence homology with other proteins, potential domains, and evolutionary conservation patterns .

For initial characterization studies, a descriptive research design is most appropriate as it helps establish the "what," "where," "when," and "how" aspects of the protein, although it may not immediately answer the "why" questions related to function .

How can researchers distinguish between experimental artifacts and genuine YDR413C properties?

When working with a poorly characterized protein like YDR413C, distinguishing between experimental artifacts and genuine properties requires multiple methodological approaches. Implementing a mixed-method research design combining both qualitative and quantitative methods is essential .

Researchers should:

  • Perform parallel experiments with appropriate positive and negative controls

  • Use different expression systems beyond E. coli to verify that observed properties are not system-dependent

  • Apply multiple detection methods for each observed property

  • Employ both tagged and untagged versions of the protein to determine tag interference

  • Utilize single-case design technical approaches with multiple baseline measurements to establish reliability

The experimental research design should include careful control of variables with specific attention to:

Variable TypeExamples for YDR413C ResearchControl Method
IndependentExpression conditions, cell type, tagsSystematic variation
DependentProtein localization, interaction partners, activityConsistent measurement protocols
ControlBackground strain characteristics, buffer conditionsStandardization across experiments

When inconsistencies arise, diagnostic research design approaches can help identify underlying factors causing experimental variations .

What genomic and proteomic databases contain the most reliable information about YDR413C?

The Saccharomyces Genome Database (SGD) serves as the primary authoritative source for YDR413C genomic information, providing the reference genome sequence from strain S288C . For researchers requiring comprehensive information, several complementary databases should be consulted:

  • SGD - For genomic context, coordinates, and basic sequence information

  • UniProt - For curated protein sequence and functional annotations

  • Pfam - For protein domain predictions

  • BioGRID - For protein-protein interaction data

  • Gene Ontology Consortium - For GO annotations related to molecular function, biological process, and cellular component

When consulting these resources, researchers should employ a systematic review approach to evaluate the quality and consistency of information across databases . This methodical comparison allows identification of consensus information versus database-specific annotations that may require experimental validation.

What expression systems are optimal for recombinant YDR413C production?

When selecting an expression system, consider:

Expression SystemAdvantages for YDR413CLimitations
E. coliHigh yield, economical, established protocols Lacks eukaryotic post-translational modifications
S. cerevisiaeNative environment, proper foldingLower yield than E. coli
Pichia pastorisHigher yield than S. cerevisiae, eukaryotic modificationsDifferent glycosylation pattern
Mammalian cellsComplex eukaryotic modificationsExpensive, technically challenging

Using an experimental research design to systematically test different expression systems can help determine which system produces functionally active protein that best represents the native state . This approach requires establishing clear criteria for success (yield, purity, activity) and conducting side-by-side comparisons.

How can researchers overcome solubility issues with recombinant YDR413C?

Solubility challenges are common with recombinant proteins and may require methodical troubleshooting. For YDR413C, which is putative and uncharacterized, researchers should implement an exploratory research design to identify optimal solubilization conditions .

Effective methodological approaches include:

  • Expression temperature optimization - Lower temperatures (16-20°C) often improve folding

  • Induction optimization - Reduced IPTG concentrations may increase soluble fraction

  • Fusion tags beyond His-tag - Consider MBP, SUMO, or GST tags known to enhance solubility

  • Codon optimization for the expression host

  • Co-expression with molecular chaperones

For difficult cases, implement a structured experimental design testing buffer conditions:

Buffer ComponentRange to TestRationale
pH6.0-9.0 in 0.5 incrementsAffects protein charge distribution
Salt concentration50-500 mM NaClShields electrostatic interactions
AdditivesGlycerol (5-15%), Arginine (50-500 mM)Stabilize hydrophobic interactions
DetergentsNon-ionic (0.01-0.1%)Mimic membrane environment if needed

Utilizing an action research design approach allows for iterative optimization based on experimental outcomes .

What experimental designs are most effective for determining YDR413C function?

Given the uncharacterized nature of YDR413C, a stepwise progression of research designs is most effective for functional determination. Begin with exploratory designs to generate hypotheses, then move to more structured experimental designs to test specific functional aspects .

The recommended methodological progression includes:

  • Bioinformatic prediction phase: Apply comparative genomics, structural prediction, and domain analysis to generate initial functional hypotheses

  • Gene knockout/knockdown phase: Implement experimental designs using CRISPR-Cas9 or traditional deletion methods to observe phenotypic changes

  • Localization studies: Apply observational research design to determine subcellular localization using fluorescent tagging and microscopy

  • Interaction studies: Use experimental designs incorporating pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation to identify interacting partners

  • Functional complementation: Design experiments where YDR413C is expressed in strains lacking functionally related genes

For each phase, researchers should implement controls addressing the six threats to internal validity described in single-case design technical documentation: ambiguous temporal precedence, selection, history, maturation, regression, and attrition .

How can researchers reliably identify interaction partners of YDR413C?

Identifying interaction partners for poorly characterized proteins like YDR413C requires multiple complementary approaches. A mixed-method research design combining different interaction detection techniques provides the most reliable results .

Methodological recommendations include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express His-tagged YDR413C in S. cerevisiae

    • Purify using nickel affinity chromatography

    • Identify co-purifying proteins via mass spectrometry

    • Validate with reciprocal tagging of identified partners

  • Yeast two-hybrid screening:

    • Use both N and C-terminal fusions to activation/binding domains

    • Screen against ordered yeast libraries

    • Validate positive interactions with secondary assays

  • Proximity-based labeling:

    • Fuse YDR413C to BioID or APEX2

    • Identify proteins in close proximity in vivo

    • Compare results with AP-MS datasets

To ensure reliable results, implement a diagnostic research design approach to identify false positives . Common filters include:

Filter TypeMethodRationale
SpecificityCompare with control purificationsEliminates non-specific binders
ReproducibilityMinimum 3 biological replicatesReduces technical artifacts
Reciprocal verificationTest interaction in reverse directionConfirms true interactions
Functional correlationGO term enrichment analysisReveals biological relevance

This systematic approach maximizes the chance of identifying physiologically relevant interaction partners of YDR413C.

What single-case design approaches are appropriate for studying YDR413C phenotypes?

For studying phenotypes associated with YDR413C, single-case design (SCD) approaches offer particular advantages, especially when phenotypes may be subtle or condition-dependent. Drawing from SCD technical documentation, researchers should implement designs that allow for within-case replication or inter-case replication with at least three demonstrations of experimental effect .

Methodological recommendations include:

  • Multiple-baseline design: Stagger the introduction of YDR413C deletions or modifications across different strain backgrounds to distinguish gene-specific effects from background effects

  • Reversal/withdrawal design (ABA design): Create a system where YDR413C expression can be conditionally regulated, allowing observation of phenotypes when the protein is present, absent, and then present again

  • Changing-criterion design: Systematically alter YDR413C expression levels to determine dose-dependent phenotypic responses

These approaches address the need for "a minimum of three demonstrations of the effect through the use of the same design and procedures" to establish experimental control and mitigate threats to internal validity . For phenotypic analysis specifically, researchers should examine characteristics like growth rate, stress resistance, metabolic profiles, and morphological features under varying conditions.

How should researchers interpret contradictory phenotypic data for YDR413C mutants?

Contradictory phenotypic data is common when studying putative uncharacterized proteins like YDR413C. Resolving these contradictions requires a methodical approach combining elements of diagnostic and causal research designs .

When faced with contradictory results, implement this systematic evaluation procedure:

  • Strain background analysis: Different S. cerevisiae strains may show distinct phenotypes due to genetic background effects

  • Environmental condition assessment: Test whether contradictions are condition-dependent (temperature, pH, carbon source, stress conditions)

  • Genetic interaction evaluation: Determine if contradictions arise from different secondary mutations or genetic interactions

  • Temporal dimension examination: Assess whether contradictions appear at different time points during growth or development

  • Methodology comparison: Evaluate whether different assay methods are contributing to apparent contradictions

Researchers should implement a longitudinal research design to track phenotypes over extended periods rather than at single time points . Additionally, cohort research design approaches can help determine if observed contradictions are specific to certain genetic backgrounds or experimental conditions .

To resolve contradictions, create a structured decision table:

Contradictory ObservationPossible ExplanationVerification Method
Growth defect present/absentMedia composition differencesStandardize media; test minimal vs. complex media
Stress sensitivity variesAssay timing differencesStandardize growth phase for testing
Localization discrepanciesTag interferenceTest multiple tag positions and types
Interaction differencesMethod sensitivity variationsCompare quantitative interaction scores

This systematic approach transforms contradictions into informative data points about condition-dependent functions of YDR413C.

How can advanced experimental designs improve our understanding of YDR413C's role in cellular pathways?

Advancing beyond basic characterization requires sophisticated experimental designs that can detect subtle and complex roles of YDR413C in cellular pathways. Implementing causal and correlational research designs in combination can provide deeper insights .

Advanced methodological approaches include:

  • Synthetic genetic array (SGA) analysis:

    • Create YDR413C deletion in arrayed yeast strain collection

    • Identify genetic interactions through growth phenotype measurements

    • Apply network analysis to position YDR413C in cellular pathways

  • Metabolomic profiling with experimental design:

    • Compare metabolite profiles between wild-type and YDR413C mutants

    • Use factorial experimental design to test environmental conditions

    • Apply time-series analysis to track metabolite changes

  • Conditional expression systems with changing-criterion design:

    • Create graded expression levels of YDR413C

    • Measure dose-dependent responses in cellular processes

    • Identify threshold effects in pathway activation

  • Integrative multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use meta-analysis research design to integrate datasets

    • Apply network reconstruction to predict pathway involvement

These approaches address the challenge that "if a participant is not responding to an intervention, then the independent variables can be manipulated while continuing to assess the dependent variable," as noted in single-case design literature .

What are the methodological challenges in determining whether YDR413C interacts with specific cellular pathways?

Determining pathway interactions for putative proteins like YDR413C presents several methodological challenges that require careful experimental design and data interpretation. Researchers should be aware of these challenges and implement appropriate controls.

Key methodological challenges and solutions include:

  • Distinguishing direct vs. indirect effects:

    • Challenge: YDR413C manipulation may cause cascade effects

    • Solution: Implement time-course experiments with short sampling intervals

    • Design approach: Use sequential research design to establish temporal relationships

  • Biological redundancy:

    • Challenge: Other proteins may compensate for YDR413C function

    • Solution: Create multiple gene deletions of related proteins

    • Design approach: Apply factorial experimental design to test combinations

  • Condition-dependent functions:

    • Challenge: YDR413C may function only under specific conditions

    • Solution: Test diverse environmental and stress conditions

    • Design approach: Implement field research design in combination with controlled laboratory conditions

  • Detection sensitivity limits:

    • Challenge: Low abundance or transient interactions may be missed

    • Solution: Apply multiple detection technologies with varying sensitivities

    • Design approach: Use mixed-method research design combining complementary techniques

When designing experiments, researchers should consider that YDR413C may have roles in multiple pathways simultaneously, necessitating a systems-level approach to analysis.

What statistical approaches are most appropriate for analyzing YDR413C functional data?

Analyzing functional data for putative uncharacterized proteins like YDR413C requires statistical approaches that can handle various data types and experimental designs. The choice of statistical methods should match the research design implemented .

Recommended statistical approaches include:

  • For exploratory data analysis:

    • Principal component analysis (PCA) to identify patterns in multivariate data

    • Hierarchical clustering to group conditions or phenotypes

    • Heat maps for visualizing patterns across multiple experiments

  • For experimental designs comparing YDR413C mutants to controls:

    • Appropriate parametric tests (t-tests, ANOVA) with correction for multiple testing

    • Non-parametric alternatives when assumptions are not met

    • Effect size calculations beyond simple p-values

  • For time-series data:

    • Repeated measures ANOVA for comparing growth curves

    • Time-series analysis methods for identifying temporal patterns

    • Area under the curve calculations for quantitative comparisons

  • For interactome data:

    • Network analysis metrics (centrality, clustering coefficient)

    • Enrichment analysis for functional categories

    • Weighted interaction scoring systems

When implementing these approaches, researchers should consider the guidance from single-case design technical documentation, which notes that "estimates of level, trend, and variability in a data series are assessed on measures within specific conditions and across time" .

How can researchers integrate multiple data types to develop comprehensive models of YDR413C function?

Integrating diverse data types is essential for developing comprehensive models of YDR413C function. This integration requires systematic meta-analysis and mixed-method research designs .

Methodological framework for data integration:

  • Data normalization and standardization:

    • Convert different data types to comparable scales

    • Implement quality control metrics for each data type

    • Create unified data matrices for integrative analysis

  • Multi-level integration approaches:

    • Bottom-up: Integrate molecular data first, then connect to phenotypes

    • Top-down: Start with phenotypes and map to underlying molecular changes

    • Middle-out: Focus on a specific process and expand in both directions

  • Computational modeling techniques:

    • Bayesian networks to integrate probabilistic relationships

    • Machine learning approaches for pattern recognition

    • Ordinary differential equations for dynamic modeling

  • Visualization strategies:

    • Multi-dimensional visualization tools

    • Layered network representations

    • Interactive visualization platforms

This integrated approach benefits from the philosophical research design perspective, which helps analyze and understand complex research problems through epistemological, ontological, and axiological frameworks .

Data TypeIntegration ChallengeSolution Approach
GenomicDifferent reference assembliesStandardize to S288C reference genome
TranscriptomicCondition-specific expressionDesign matched conditions across experiments
ProteomicSensitivity differencesNormalize using housekeeping proteins
InteractomicFalse positive ratesApply confidence scoring systems
PhenomicQualitative vs. quantitative dataDevelop standardized phenotype ontologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.