Recombinant YDR417C is a 123-amino acid protein produced in Saccharomyces cerevisiae (strain ATCC 204508/S288c) with an N-terminal tag determined during production. The protein sequence spans residues 25–123 (full-length: KEEADGTTEAAACLFWIFNWTVTLIPLNSLVALAISSPTFFGDKPNGPIFGAKAAEAPTS PPTALKYKYLTSFGSNFGGILTIDLSFYWALGVALTGSK) and is stored in Tris-based buffer with 50% glycerol at -20°C .
| Parameter | Details |
|---|---|
| Molecular Weight | ~14 kDa (calculated) |
| Uniprot ID | P87267 |
| Genomic Coordinates | Chromosome IV: 1,359,804–1,360,181 |
| Overlapping Gene | RPL12B/YDR418W (ribosomal protein L12B) |
YDR417C is classified as a dubious open reading frame (DOF) with no detectable protein expression in systematic studies . Key findings include:
Lack of Functional Evidence: No detectable protein expression was observed in GFP- or TAP-tagged strains .
Ribosomal Proximity: Predicted interaction partners include ribosomal proteins (RPL12B, RPL19B) and cell wall regulators (LRE1) .
Metabolic Impact: Deletion strains show altered amino acid profiles (e.g., elevated asparagine, reduced glutamine) under exponential growth, suggesting indirect metabolic roles .
Despite its DOF status, recombinant YDR417C is commercially available for immunological and biochemical studies . Potential applications include:
Antibody Production: Used as an antigen due to its recombinant purity.
Cell Wall Studies: Interactions with LRE1 (laminarase-resistance protein) hint at roles in stress response pathways .
YDR417C resides in a genomic region with overlapping functional elements:
| Feature | Relationship to YDR417C |
|---|---|
| RPL12B/YDR418W | Overlapping verified ribosomal gene |
| Evolutionary Conservation | Absent in closely related Saccharomyces species |
Deletion of YDR417C causes significant changes in amino acid homeostasis :
| Amino Acid | Change (vs Wild Type) | p-Value (Adjusted) |
|---|---|---|
| Asparagine | +2.1σ | 1.2×10⁻³ |
| Glutamine | -1.8σ | 4.5×10⁻³ |
| Proline | +1.5σ | 0.022 |
Multivariate analysis (Mahalanobis distance: 8.7, p < 0.001) confirms systemic metabolic disruption .
The protein’s biological relevance remains debated:
SGD Classification: Annotated as non-functional due to lack of conservation and expression evidence .
Commercial Availability: Sold as a recombinant protein despite uncertain biological role .
Interaction Network: STRING database links it to ribosomal and stress-response pathways (confidence score: 0.698 for RPL12B interaction) .
Expression Validation: Confirm protein expression using advanced detection methods.
Pathway Mapping: Investigate its role in ribosomal or cell wall integrity pathways via CRISPR-Cas9 screens.
Structural Studies: Resolve 3D structure to assess potential functional domains.
STRING: 4932.YDR417C
YDR417C is a putative uncharacterized protein in the model organism Saccharomyces cerevisiae. While specific functions have not been fully elucidated, it is listed in protein-protein interaction databases such as STRING, suggesting potential functional relationships with other yeast proteins . Current research approaches often utilize deletion strains and functional genomics methods to investigate such uncharacterized proteins, similar to techniques used for studying other yeast genes involved in stress responses and DNA damage repair pathways .
Saccharomyces cerevisiae itself serves as an excellent model system for studying YDR417C, offering several advantages:
Well-characterized genome and proteome
Availability of deletion libraries and genetic manipulation tools
Rapid growth and ease of maintenance
Established protocols for protein expression and purification
For studying YDR417C, researchers can employ systems similar to those used for other yeast proteins, including deletion strain analysis, overexpression systems, and heterologous protein production platforms . When expressing recombinant versions, it's important to consider that overexpression of some yeast proteins can affect cellular functions, necessitating careful experimental design with appropriate controls .
To identify potential orthologs:
Perform sequence-based analyses using BLAST against various genomic databases
Analyze protein domain architecture using tools like Pfam and InterPro
Use phylogenetic analysis to establish evolutionary relationships
Search specialized ortholog databases such as OMA, EggNOG, or OrthoDB
The conservation pattern across species can provide initial clues about functional importance. For proteins like YDR417C, functional characterization in yeast can potentially inform understanding of related proteins in other organisms, similar to approaches used in ADAR research where yeast systems inform mammalian biology despite lacking endogenous expression of these enzymes .
Based on methodologies applied to similar uncharacterized yeast proteins, the following approaches are recommended:
Deletion Strain Phenotyping: Create YDR417C deletion strains and assess growth under various stress conditions including radiation, chemical stressors (MMS, HU, doxorubicin), and metabolic challenges . This approach revealed that deletion of genes like YAF9 resulted in enhanced sensitivity to S-phase specific inhibitors and DNA damaging agents .
High-throughput Screening: Employ systematic screens to identify genetic and physical interaction partners. For example, screening for sensitivity to zymocin revealed connections between transcription factors and DNA repair mechanisms .
Integrative Omics Analysis: Combine transcriptomic, proteomic, and metabolomic approaches to identify pathways affected by YDR417C deletion or overexpression.
| Experimental Approach | Expected Outcomes | Technical Considerations |
|---|---|---|
| Deletion strain phenotyping | Growth profiles under various stressors | Control for genetic background; confirm deletion by PCR |
| Synthetic genetic arrays | Identification of genetic interactions | Use appropriate statistical methods to identify significant interactions |
| Protein localization studies | Subcellular localization pattern | Consider tagging effects on protein function |
| Transcriptome analysis | Gene expression changes | Account for direct vs. indirect effects |
For effective expression and characterization of YDR417C:
Optimize Expression Conditions: When designing expression systems, consider using inducible promoters (like GAL1) to control expression levels and timing . This is particularly important as some yeast proteins may cause toxicity when overexpressed.
Purification Strategy: Develop a purification protocol that maintains protein stability and activity. Saccharomyces cerevisiae has proven valuable for high-yield purification of proteins where stability and activity were challenges in other systems .
Functional Tagging: When adding epitope tags for detection or purification, verify that the tag doesn't interfere with protein function. Position tags at either N- or C-terminus and compare activities to determine optimal configuration.
Expression Verification: Use methods like Western blotting to confirm expression levels, similar to approaches used in studies of other recombinant proteins in yeast .
The selection of appropriate host strains is critical, as demonstrated in systems designed to overproduce heterologous proteins in S. cerevisiae . Different backgrounds may yield significantly different expression levels and protein stability.
When investigating an uncharacterized protein like YDR417C, consider:
Hypothesis Generation Through Data Mining: Analyze existing datasets for clues about function. Check if YDR417C appears in any genomic screens or if its expression correlates with specific conditions or genetic backgrounds.
Comparative Analysis: Design experiments that compare YDR417C to proteins with similar sequences, domains, or expression patterns. This can provide initial functional hypotheses.
Systematic Perturbation Analysis: Design experiments that expose YDR417C deletion or overexpression strains to diverse environmental conditions, focusing on conditions that might reveal phenotypes .
Statistical Rigor: Ensure experiments include appropriate replicates and controls, following established guidelines for experimental design in biological research . For complex experiments, consider consulting statistical resources specialized for biological data analysis.
To investigate protein-protein interactions:
Co-immunoprecipitation Studies: Design with appropriate epitope tags and controls to validate interactions observed in high-throughput studies.
Yeast Two-Hybrid Screens: Use YDR417C as both bait and prey to identify potential interacting partners. Consider using domain-specific constructs if the full protein yields non-specific results.
Proximity-Based Labeling: Methods like BioID or APEX can identify proteins in close proximity to YDR417C under native conditions.
When reporting interaction data, organize findings in clear tables following best practices for scientific data presentation :
| Technique | Identified Interactors | Validation Method | Functional Category |
|---|---|---|---|
| Co-IP/MS | [Protein A, Protein B...] | Reciprocal Co-IP | [e.g., DNA repair] |
| Y2H | [Protein C, Protein D...] | GST pull-down | [e.g., Transcription] |
| BioID | [Protein E, Protein F...] | Co-localization | [e.g., Stress response] |
When facing conflicting results:
Systematic Investigation of Variables: Methodically examine experimental conditions that might explain discrepancies, such as strain background differences, media composition, or growth conditions.
Replication with Standardized Methods: As noted in the research on rescue of BRCA1-induced lethality, inconsistent results may arise from technical issues like cross-contamination or small sample sizes . The study authors addressed this by planning to "repeat this rescue experiment with a freshly retransformed ylr412WA where the efficiency of transformation is high."
Integrated Data Analysis: Use approaches that integrate multiple data types to develop a consensus model of function, giving appropriate weight to different evidence types.
Alternative Hypothesis Formulation: When data conflicts persist, develop alternative models that might explain the discrepancies and design critical experiments to distinguish between them.
For rigorous statistical analysis:
Appropriate Statistical Tests: Select tests based on data distribution and experimental design. For growth assays, consider repeated measures ANOVA or mixed models for time-course data.
Multiple Testing Correction: When performing multiple comparisons, apply appropriate corrections (e.g., Bonferroni, Benjamini-Hochberg FDR) to control false discovery rates.
Effect Size Reporting: Report not only p-values but also effect sizes and confidence intervals to convey biological significance.
Visualization Best Practices: Present data using appropriate visualizations that clearly communicate results, following guidelines for effective use of tables and figures in research papers .
The textbook "Experimental Design and Data Analysis for Biologists" provides comprehensive guidance on statistical approaches appropriate for biological data analysis, including regression techniques, ANOVA models, and multivariate methods that might be applicable to YDR417C studies .
To explore stress response connections:
Stress-Specific Phenotyping: Test YDR417C deletion and overexpression strains under various stressors, including those that induce DNA damage (IR, MMS, HU), oxidative stress (H₂O₂), or proteotoxic stress (heat shock, chemical chaperone inhibitors).
Pathway-Focused Analysis: Compare phenotypes to those of known stress response pathway components. The approach used to identify rescue of BRCA1-induced lethality by deletion of specific genes could serve as a model .
Transcriptional Response Mapping: Analyze transcriptional changes in YDR417C mutants under stress conditions to identify affected pathways.
Epistasis Analysis: Construct double mutants with known stress response genes to determine if YDR417C functions within established pathways or represents a novel response mechanism.
As observed with genes like YAF9, deletion of uncharacterized genes may reveal unexpected connections to specific stress response mechanisms, such as enhanced sensitivity to S-phase specific inhibitors indicating "a possible replication repair associated defect" .
Based on findings with other yeast proteins:
Chromatin Association Studies: Use ChIP-seq to determine if YDR417C associates with specific genomic regions, similar to studies that identified YAF9 as a transcription factor .
Transcriptome Analysis: Compare gene expression profiles between wild-type and YDR417C deletion strains under various conditions.
Protein Domain Analysis: Analyze YDR417C for domains commonly found in transcriptional regulators, such as DNA-binding motifs or interaction domains for chromatin-modifying complexes.
Genetic Interaction Mapping: Test for genetic interactions with known transcriptional machinery components. The observation that "genes required for the repair of IR-induced DSBs including members of the RAD52, RAD6 and RAD9 epistasis groups all show enhanced sensitivity to the lethal effects of zymocin" demonstrates how such analyses can reveal functional connections.
Interestingly, several DNA repair genes showed heightened sensitivity to zymocin, which reportedly "inhibits transcription and results in DSB damage" . This suggests complex relationships between transcription, DNA damage, and cellular survival that could be relevant to understanding YDR417C function.
Translating yeast findings to human biology:
Identification of Human Orthologs: If orthologs exist, compare functional domains and conservation patterns to predict potential roles in human cells.
Disease-Associated Variants: Examine if human orthologs have variants associated with disease phenotypes, which could be modeled in yeast.
Pathway Conservation Analysis: Even without direct orthologs, the pathways in which YDR417C functions may be conserved. For example, the DNA repair and transcription regulation pathways identified in yeast often have human counterparts .
Therapeutic Target Evaluation: If YDR417C influences cellular responses to stressors like radiation or chemotherapeutics, human orthologs might represent potential therapeutic targets.
The study of BRCA1 effects in yeast demonstrates how yeast models can inform understanding of human disease genes . Similarly, yeast systems have proven valuable for studying human proteins like ADARs, even though yeast lacks these enzymes endogenously .
For translational verification:
Ortholog Complementation: Test if human orthologs can complement YDR417C deletion phenotypes in yeast.
CRISPR-Based Manipulation: Use CRISPR/Cas9 to modify potential orthologs in mammalian cells and assess phenotypes comparable to those observed in yeast.
Conserved Interaction Verification: Validate whether protein interactions identified in yeast are conserved in mammalian systems.
siRNA Technology Application: Apply siRNA approaches to down-regulate expression of orthologous genes in human cells, similar to the approach described for studying BRCA1-interacting genes .
The successful use of yeast for studying proteins like ADARs demonstrates how yeast can be "an invaluable asset" in research, "facilitating significant advances in our understanding of mechanisms and therapeutic applications" even for proteins not natively expressed in yeast .