Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR442W (YDR442W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
YDR442W; Putative uncharacterized protein YDR442W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR442W
Target Protein Sequence
MSRKTLPEKVYLSERIIDEEVAVCTVAAEVLAIFTLVCTRVFIIFFTARICHGIWPSSPS ERPYHTFRAARLRNSSKMVSSNCVLSECGQFKRLTANLSQTVSPSHFLNLIKAPLLIAQR CCECASGNGC
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR442W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of YDR442W protein?

YDR442W is a putative uncharacterized protein from Saccharomyces cerevisiae with a full length of 130 amino acids . While the complete three-dimensional structure has not been fully resolved, researchers can approach structure determination through multiple methodologies. X-ray crystallography remains the gold standard, requiring high-purity recombinant protein preparations. Alternative approaches include nuclear magnetic resonance (NMR) spectroscopy for smaller domains and cryo-electron microscopy for larger complexes. Computational prediction tools like AlphaFold can provide preliminary structural models based on amino acid sequence, offering initial insights into potential functional domains and protein folding patterns.

How can I express and purify recombinant YDR442W protein for experimental studies?

Recombinant YDR442W can be successfully expressed in E. coli expression systems using a His-tag approach . The recommended expression protocol involves:

  • Cloning the YDR442W coding sequence (1-130 amino acids) into a bacterial expression vector with an N-terminal or C-terminal His-tag

  • Transforming the construct into an E. coli strain optimized for protein expression (BL21(DE3) or Rosetta)

  • Inducing expression with IPTG at lower temperatures (16-25°C) to enhance proper folding

  • Lysing cells under native conditions using sonication or pressure-based disruption

  • Purifying using nickel affinity chromatography followed by size exclusion chromatography

For experimental applications requiring higher purity, additional purification steps such as ion exchange chromatography may be necessary. Expression yields can be optimized by adjusting induction parameters and growth conditions based on experimental design principles .

What experimental approaches are recommended for initial functional characterization of YDR442W?

Initial functional characterization should follow a systematic approach combining multiple techniques:

  • Subcellular localization: Fluorescent tagging (GFP fusion) followed by confocal microscopy to determine cellular compartmentalization

  • Protein-protein interaction studies: Yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling techniques (BioID, APEX)

  • Expression profiling: RT-qPCR analysis across different growth conditions and cell cycle stages

  • Phenotypic analysis: Growth curve analysis comparing wild-type and YDR442W deletion strains under various stressors

  • Comparative genomics: Alignment with homologs from related yeast species to identify conserved domains

These approaches should be conducted following proper experimental design principles, including appropriate controls, biological replicates, and statistical analyses . The experimental design should account for potential confounding variables such as growth conditions, strain background, and expression levels.

How can I design a CRISPR-Cas9 knockout/knockdown system to study YDR442W function in S. cerevisiae?

Designing a CRISPR-Cas9 system for YDR442W requires careful consideration of several factors:

  • Guide RNA (gRNA) design: Select 2-3 target sequences within the YDR442W coding region using tools like CHOPCHOP or E-CRISP that score high for on-target efficiency and low for off-target effects

  • Delivery system: For S. cerevisiae, a plasmid-based system expressing both Cas9 and the gRNA is most efficient

  • Repair template: Design a homology-directed repair (HDR) template that includes:

    • Homology arms (500-1000 bp) flanking the cut site

    • A selection marker (e.g., antibiotic resistance)

    • Optional epitope tags for tracking expression

To verify knockout efficiency:

  • Perform PCR genotyping across the modification site

  • Conduct Western blotting with antibodies against YDR442W

  • Sequence the modified locus to confirm precise editing

For knockdown rather than knockout, consider a CRISPRi approach using a catalytically dead Cas9 (dCas9) fused to a repressor domain. This experimental design should include appropriate controls following established principles of genetic manipulation .

What interactome mapping approaches would be most effective for identifying YDR442W protein interaction networks?

For comprehensive interactome mapping of YDR442W, a multi-method approach is recommended:

  • Affinity purification-mass spectrometry (AP-MS): Express His-tagged YDR442W , perform pulldowns under native conditions, and identify co-purifying proteins by LC-MS/MS

  • Proximity-based labeling: Fuse YDR442W with BioID or APEX2, express in yeast, and identify proximal proteins after biotin labeling

  • Yeast two-hybrid (Y2H) screening: Use YDR442W as bait against a S. cerevisiae genomic library

  • Protein complementation assays: Split-reporter systems (e.g., split-GFP) to validate direct interactions in vivo

Data integration is critical - interactions identified by multiple methods should be prioritized. Validation experiments should include:

  • Co-immunoprecipitation of prioritized interactions

  • Fluorescence co-localization studies

  • Functional studies to assess biological relevance of interactions

When analyzing interactome data, compare results with existing S. cerevisiae protein interaction databases to identify novel versus previously known interactions. This integrative approach minimizes false positives inherent to any single method.

How does YDR442W compare with homologs in other yeast species, and what can this tell us about its function?

Comparative genomic analysis of YDR442W should follow this methodological approach:

  • Sequence similarity search:

    • BLAST the YDR442W protein sequence against fungal genome databases

    • Perform PSI-BLAST for more sensitive detection of distant homologs

    • Search specialized yeast databases for curated annotations

  • Multiple sequence alignment and phylogenetic analysis:

    • Align YDR442W with identified homologs using MUSCLE or MAFFT

    • Construct phylogenetic trees using maximum likelihood methods

    • Map synteny relationships across different yeast species

  • Conservation pattern analysis:

    • Identify highly conserved residues/motifs across species

    • Calculate selection pressure (dN/dS ratios) across the alignment

    • Map conservation onto predicted structural models

  • Functional inference:

    • Compare expression patterns of homologs in other species

    • Look for co-evolution with functionally characterized proteins

    • Analyze gene neighborhood conservation (synteny)

When analyzing comparative genomics data for S. cerevisiae proteins like YDR442W, remember that S. cerevisiae underwent whole-genome duplication, which may complicate orthology assignments. Additionally, as seen with other S. cerevisiae strains like CBS 493.94, genomic data can provide insights into strain-specific adaptations that might influence protein function .

What can whole genome sequencing data tell us about the genomic context of YDR442W in different S. cerevisiae strains?

Whole genome sequencing (WGS) data analysis for understanding YDR442W genomic context should include:

  • Comparative genomic location analysis:

    • Map YDR442W locus across multiple sequenced S. cerevisiae strains

    • Identify copy number variations or gene duplications

    • Analyze upstream and downstream regulatory regions for conservation

    • Examine chromosome structure and potential rearrangements affecting YDR442W

  • Regulatory element analysis:

    • Identify transcription factor binding sites in promoter regions

    • Analyze chromatin structure data (if available) for accessibility

    • Map epigenetic modifications that might influence expression

  • Variant impact prediction:

    • Identify SNPs and indels within and around YDR442W across strains

    • Predict functional consequences of coding variants

    • Correlate genetic variations with strain-specific phenotypes

How should I design experiments to determine if YDR442W is involved in specific cellular pathways?

To systematically investigate YDR442W's involvement in cellular pathways:

  • Pathway-specific stress tests:

    • Expose YDR442W deletion/overexpression strains to various stressors:

      • Oxidative stress (H₂O₂, menadione)

      • DNA damage (UV, MMS)

      • Metabolic stressors (carbon source variations)

      • Temperature stress (heat shock, cold shock)

    • Measure survival rates, growth curves, and recovery times

    • Compare with known pathway mutants as positive controls

  • Transcriptomic analysis:

    • Perform RNA-Seq comparing wild-type and YDR442W mutant strains

    • Analyze under both standard and stress conditions

    • Identify differentially expressed genes and perform pathway enrichment analysis

    • Validate key findings with RT-qPCR

  • Genetic interaction screening:

    • Perform synthetic genetic array (SGA) analysis with YDR442W deletion

    • Create double mutants with genes from suspected pathways

    • Score for synthetic lethality or rescue phenotypes

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and mutant strains

    • Focus on metabolites relevant to suspected pathways

    • Correlate changes with phenotypic observations

The experimental design should follow proper scientific principles including appropriate controls, biological replicates (minimum n=3), and statistical analysis to ensure reproducibility and validity . Variables such as growth stage, media composition, and environmental conditions should be carefully controlled.

What approaches can resolve contradictory data when studying YDR442W function?

When facing contradictory data in YDR442W research:

  • Systematic validation with independent methods:

    • Verify protein-protein interactions using complementary techniques:

      • If Y2H shows an interaction but co-IP doesn't, try proximity labeling

      • Validate RNA-Seq findings with RT-qPCR and protein-level analysis

    • Use different strain backgrounds to rule out strain-specific effects

    • Employ both deletion and controlled expression (e.g., tetracycline-regulated) systems

  • Condition-dependent analysis:

    • Test function under varied conditions:

      • Growth phases (log, stationary)

      • Nutrient availability

      • Stress conditions

      • Temperature ranges

    • Map conditional dependencies of contradictory results

  • Collaborative cross-validation:

    • Exchange materials (strains, constructs) with collaborating labs

    • Standardize protocols between research groups

    • Perform blinded analyses of shared samples

  • Statistical and computational approaches:

    • Use meta-analysis techniques to integrate conflicting datasets

    • Apply Bayesian frameworks to weigh evidence from different experiments

    • Perform sensitivity analyses to identify potential confounding variables

  • Addressing technical limitations:

    • Consider protein tag interference with function

    • Evaluate artificial overexpression artifacts

    • Check for off-target effects in genetic manipulations

This systematic approach helps identify whether contradictions represent biological complexity (e.g., context-dependent function) or technical artifacts, following established principles of experimental design .

How can post-translational modifications of YDR442W be comprehensively mapped?

For comprehensive PTM mapping of YDR442W:

  • Mass spectrometry-based approaches:

    • Enrichment strategies for specific PTMs:

      • Phosphorylation: TiO₂ or IMAC enrichment

      • Ubiquitination: K-ε-GG antibody enrichment

      • Glycosylation: Lectin affinity or hydrazide chemistry

    • Multiple proteolytic digestions (trypsin, chymotrypsin, Glu-C) for optimal coverage

    • Data-dependent and data-independent acquisition methods

    • Targeted analysis for site validation using parallel reaction monitoring

  • Site-specific validation:

    • Generation of site-specific antibodies for key PTMs

    • Site-directed mutagenesis of modified residues

    • Phenotypic analysis of PTM site mutants

  • Dynamic PTM profiling:

    • Temporal analysis across cell cycle or stress responses

    • Quantitative proteomics with stable isotope labeling

    • Pulse-chase experiments to determine PTM turnover rates

  • PTM crosstalk analysis:

    • Hierarchical modification patterns

    • Sequential enrichment strategies

    • Analysis of modification interdependencies

  • Functional consequence assessment:

    • Compare activity of modified versus unmodified protein

    • Create phosphomimetic and non-phosphorylatable mutants

    • Analyze interaction partners specific to modification states

When working with recombinant His-tagged YDR442W , remember that E. coli expression systems lack many eukaryotic PTM enzymes, necessitating complementary analysis of native protein from yeast or expression in eukaryotic systems for complete PTM profiling.

How can multi-omics data be integrated to develop hypotheses about YDR442W function?

For effective multi-omics data integration regarding YDR442W:

  • Data collection and preprocessing:

    • Generate or collect data across multiple platforms:

      • Transcriptomics (RNA-Seq of YDR442W mutants)

      • Proteomics (interactome data, abundance changes)

      • Metabolomics (metabolite profiles in deletion strains)

      • Genomics (synteny, conservation patterns)

    • Normalize and transform data for cross-platform compatibility

    • Implement quality control measures for each data type

  • Integration methodologies:

    • Network-based integration:

      • Construct protein-protein interaction networks with YDR442W

      • Overlay transcriptional and metabolic changes

      • Identify network modules affected by YDR442W perturbation

    • Statistical integration:

      • Canonical correlation analysis between omics layers

      • Bayesian networks to infer causal relationships

      • Supervised learning approaches to classify YDR442W function

  • Visualization and hypothesis generation:

    • Interactive visualization tools for integrated networks

    • Pathway enrichment analysis across multiple data types

    • Identification of recurring patterns across omics layers

    • Comparison with other putative uncharacterized proteins

  • Experimental validation planning:

    • Prioritize hypotheses based on evidence strength

    • Design targeted experiments to test specific predictions

    • Iteratively refine models based on new experimental data

This methodological framework provides a systematic approach to generate testable hypotheses about YDR442W function from diverse data types, following principles of rigorous experimental design . Remember that while commercial tools exist for data mining, the research focus should remain on scientific understanding rather than commercial applications.

What bioinformatic resources and tools are most useful for studying uncharacterized proteins like YDR442W?

For comprehensive bioinformatic analysis of uncharacterized proteins like YDR442W:

  • Sequence analysis tools:

    • Sequence homology: BLAST, HMMER, PSI-BLAST

    • Multiple sequence alignment: MUSCLE, MAFFT, T-Coffee

    • Domain prediction: InterPro, Pfam, SMART

    • Secondary structure prediction: PSIPRED, JPred

    • Disorder prediction: IUPred, PONDR

  • Structure prediction resources:

    • Homology modeling: SWISS-MODEL, I-TASSER

    • Ab initio modeling: Rosetta, AlphaFold

    • Model validation: MolProbity, PROCHECK

    • Visualization: PyMOL, Chimera

  • Functional annotation tools:

    • GO term prediction: PANNZER, DeepGOPlus

    • Enzyme classification: EFICAz, EnzymeMiner

    • Ligand binding prediction: COACH, FunFOLD

    • Subcellular localization: DeepLoc, WoLF PSORT

  • Yeast-specific resources:

    • Saccharomyces Genome Database (SGD)

    • Yeast Metabolome Database (YMDB)

    • FungiDB integrated genomic database

    • PomBase (for comparison with S. pombe)

  • Integrated analysis platforms:

    • Workflow management: Galaxy, Taverna

    • Integrative genomics: KBase, GenomeSpace

    • Network analysis: Cytoscape, STRING

    • Comparative genomics: Ensembl Fungi, OrthoMCL

These bioinformatic resources should be used in a complementary manner, as each has strengths and limitations. Results from computational predictions should guide experimental design rather than being considered definitive without validation, following proper experimental design principles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.