Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR509W (YDR509W)

Shipped with Ice Packs
In Stock

Description

Introduction to YDR509W

Saccharomyces cerevisiae serves as one of the most important model organisms in molecular biology and genetics research. The comprehensive sequencing of its genome revealed numerous open reading frames encoding proteins with unknown functions, including YDR509W located on chromosome IV of the S. cerevisiae genome .

The designation "putative uncharacterized protein" indicates that while bioinformatic analysis suggests YDR509W is a protein-coding gene, experimental validation of its function remains limited. Understanding such uncharacterized proteins is crucial for completing our knowledge of the functional proteome of S. cerevisiae, which enhances our understanding of fundamental eukaryotic cellular processes.

The availability of recombinant forms of YDR509W enables researchers to conduct biochemical and structural studies that might reveal its biological roles. In the broader context of yeast biology research, S. cerevisiae has provided valuable insights into conserved eukaryotic cellular mechanisms, with many proteins initially characterized in yeast later found to have important homologs in higher organisms including humans .

Protein Structure and Sequence

YDR509W consists of 115 amino acids in its full-length native form. The recombinant version available for research includes an N-terminal histidine tag that facilitates purification without significantly altering the protein's fundamental properties . The complete amino acid sequence of YDR509W is presented in Table 1.

Table 1: Amino Acid Sequence of YDR509W Protein

ProteinComplete Amino Acid Sequence
YDR509WMMFTFIFHIFNGFFHCFFKIFYFIFRFYRANLFFLWLYFLHLVMGNIVKVVTIHIHIRASLIIPPMASITKRHNVQYLILYKLLEKAIVFFSYTKKKKHKAPITLNFEEARKEYV

A notable feature of this sequence is the high concentration of hydrophobic amino acids, particularly phenylalanine (F) and isoleucine (I) in the N-terminal region. This unusual clustering of hydrophobic residues might suggest potential membrane association or involvement in protein-protein interaction domains. The sequence composition indicates potential for both alpha-helical and beta-sheet secondary structural elements, though detailed three-dimensional structural information remains unavailable.

Physical and Biochemical Properties

The recombinant YDR509W protein is supplied as a lyophilized powder with specific physicochemical properties that are important for research applications . These properties are summarized in Table 2.

Table 2: Physical and Biochemical Properties of Recombinant YDR509W

PropertySpecification
SourceE. coli expression system
TagN-terminal His tag
Protein LengthFull Length (1-115 amino acids)
FormLyophilized powder
PurityGreater than 90% (determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ApplicationsSDS-PAGE

The molecular weight of the native 115-amino acid protein can be estimated at approximately 13-14 kDa, with the addition of the His-tag potentially adding around 1 kDa to the total molecular weight. The high level of purity (>90%) makes this preparation suitable for various research applications where contaminants might interfere with experimental results.

Expression Systems

The recombinant YDR509W protein is produced using Escherichia coli as the expression host . E. coli represents one of the most widely used expression systems for recombinant protein production due to its rapid growth, well-characterized genetics, and relatively simple cultivation requirements.

For the production of recombinant YDR509W, the gene encoding the full-length protein (amino acids 1-115) from Saccharomyces cerevisiae is cloned into an appropriate expression vector that includes sequences for an N-terminal histidine tag. This construct is then transformed into E. coli cells for protein expression.

The successful expression of this eukaryotic protein in a prokaryotic host suggests that YDR509W does not require extensive post-translational modifications or eukaryotic-specific folding machinery for its basic structural integrity. This characteristic facilitates its production in high yields using bacterial systems, making it readily available for research applications.

Purification Techniques

The inclusion of an N-terminal histidine tag in the recombinant YDR509W protein enables purification using immobilized metal affinity chromatography (IMAC) . This approach allows for efficient separation of the target protein from the complex mixture of E. coli cellular proteins.

Standard purification procedures for His-tagged proteins typically involve:

  1. Cell lysis to release cellular contents

  2. Clarification of the lysate to remove insoluble material

  3. Binding of the tagged protein to metal affinity resin

  4. Washing steps to remove non-specifically bound proteins

  5. Elution of the target protein using imidazole competition or pH changes

  6. Buffer exchange and concentration of the purified protein

The final product undergoes lyophilization with a protective buffer containing 6% trehalose, which helps maintain protein structure during freeze-drying and subsequent reconstitution. The reported purity of greater than 90% as determined by SDS-PAGE indicates effective purification suitable for most research applications.

Current Research Applications

Based on available information, the primary application of recombinant YDR509W appears to be in basic research aimed at characterizing this putative uncharacterized protein . SDS-PAGE is specifically mentioned as an application, suggesting its use in protein expression and purification validation studies.

The availability of purified recombinant YDR509W enables researchers to conduct experiments that might reveal its biological function through approaches such as:

  1. Antibody generation for localization and expression studies

  2. Protein interaction studies to identify binding partners

  3. Structural analysis through crystallography, NMR, or cryo-electron microscopy

  4. Functional assays to determine potential biochemical activities

While YDR509W remains uncharacterized, research on other yeast proteins has demonstrated the value of systematic studies of the yeast proteome. For instance, comprehensive structural and functional studies of the S. cerevisiae APC/C (Anaphase-Promoting Complex/Cyclosome) have revealed important insights into protein complex assembly and regulation that are conserved from yeast to humans .

Future Research Directions

The study of uncharacterized proteins like YDR509W contributes to the broader goal of functional genomics – assigning biological functions to all genes in an organism's genome. Future research directions might include:

  1. Comparative analysis with potential homologs in other yeast species or higher eukaryotes

  2. Investigation of expression patterns under various cellular conditions

  3. Targeted gene deletion or mutation studies to observe phenotypic effects

  4. Systematic interaction screening with known protein complexes

The unique amino acid sequence of YDR509W, particularly its high content of hydrophobic residues, suggests potential involvement in membrane interactions or specialized protein-protein interfaces, which could be explored in future research.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
YDR509W; Putative uncharacterized protein YDR509W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR509W
Target Protein Sequence
MMFTFIFHIFNGFFHCFFKIFYFIFRFYRANLFFLWLYFLHLVMGNIVKVVTIHIHIRAS LIIPPMASITKRHNVQYLILYKLLEKAIVFFSYTKKKKHKAPITLNFEEARKEYV
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR509W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YDR509W and what do we currently know about its basic properties?

YDR509W is a putative uncharacterized protein from the model organism Saccharomyces cerevisiae (baker's yeast). Current data indicates it is a relatively small protein consisting of 115 amino acids . As an uncharacterized protein, its biological function, cellular localization, and interaction partners remain largely unknown. The protein has been cataloged in yeast genomic databases, but extensive functional characterization is still pending.

The protein can be recombinantly produced with a histidine tag in E. coli expression systems, which facilitates purification through metal affinity chromatography . While the protein's sequence is documented, the three-dimensional structure, post-translational modifications, and biochemical activities have yet to be thoroughly investigated.

How does YDR509W fit into the broader context of uncharacterized proteins in S. cerevisiae?

S. cerevisiae was the first eukaryotic organism to have its genome fully sequenced, yet many of its proteins remain functionally uncharacterized despite decades of research. YDR509W represents one of these knowledge gaps in our understanding of yeast biology.

Uncharacterized proteins like YDR509W are particularly intriguing because S. cerevisiae serves as a fundamental model organism for eukaryotic cell biology . The lack of identified pathway involvement or interaction partners for YDR509W, as evidenced by the empty tables in database entries, indicates it may have specialized functions or may be expressed only under specific conditions not routinely tested in standard laboratory experiments .

Studying proteins like YDR509W contributes to completing our understanding of the yeast proteome and potentially reveals novel cellular mechanisms that may be conserved in more complex eukaryotes, including humans.

What experimental design would be optimal for determining the cellular function of YDR509W?

A comprehensive experimental design to determine YDR509W function would involve multiple complementary approaches:

Stage 1: Initial Characterization

  • Transcriptomic analysis across various conditions to identify when YDR509W is expressed

  • Fluorescent tagging (GFP fusion) to determine subcellular localization

  • Phenotypic assessment of knockout strains (Δydr509w) under diverse stress conditions

  • Overexpression analysis to identify gain-of-function phenotypes

Stage 2: Interaction Partners and Pathways

  • Affinity purification coupled with mass spectrometry (AP-MS) to identify protein-protein interactions

  • Synthetic genetic array (SGA) analysis to identify genetic interactions

  • Chromatin immunoprecipitation (ChIP) if nuclear localization is observed

  • Metabolomic profiling of knockout vs. wild-type strains

Stage 3: Biochemical Function

  • In vitro enzymatic assays based on predictions from structural analysis

  • Structural determination via X-ray crystallography or cryo-EM

  • Complementation studies with orthologs from related species

This multi-stage approach would utilize S. cerevisiae's genetic tractability and the arsenal of techniques developed for yeast research . Key to success would be testing under varied conditions (temperature, carbon source, stressors) since uncharacterized proteins often have functions that only manifest under specific circumstances.

How should researchers approach experimental design when studying potentially essential but uncharacterized yeast proteins like YDR509W?

When studying potentially essential uncharacterized proteins, researchers should implement a conditional approach to experimental design:

Conditional Expression Systems:

  • Tetracycline-repressible promoter system (Tet-Off)

  • Glucose-repressible GAL promoter system

  • Temperature-sensitive degron tags

These systems allow tight control over protein expression or stability, permitting researchers to deplete the protein and observe consequences without creating non-viable strains.

Experimental Protocol Framework:

  • Replace the native YDR509W promoter with a regulatable promoter

  • Confirm conditional expression through Western blotting

  • Perform growth curve analysis under repressing conditions

  • Conduct transcriptomic and proteomic profiling at multiple timepoints after repression

  • Analyze cellular morphology and key physiological parameters during depletion

  • Perform high-throughput phenotypic screening under various stressors during partial depletion

This approach would leverage the genetic engineering capabilities of S. cerevisiae, particularly its efficient homologous recombination, to create strains where YDR509W expression can be precisely controlled . The experimental design should include appropriate controls and biological replicates to ensure reliable data interpretation, especially when dealing with subtle phenotypes that may arise from manipulating uncharacterized proteins.

What expression systems and purification strategies are most effective for recombinant production of S. cerevisiae YDR509W?

Based on current practices in recombinant yeast protein production, the following expression systems and purification strategies would be most effective for YDR509W:

Expression Systems Comparison:

Expression HostAdvantagesDisadvantagesRecommendation for YDR509W
E. coli- Rapid growth
- High yields
- Simple media requirements
- Established for YDR509W
- Lack of eukaryotic PTMs
- Potential folding issues
- Potential toxicity
Primary system for initial structural studies
S. cerevisiae- Native environment
- Proper folding
- Eukaryotic PTMs
- Homologous recombination
- Lower yields
- Slower growth
- More complex media
Optimal for functional studies
P. pastoris- Higher expression than S. cerevisiae
- Scalable
- Strong inducible promoters
- Less genetic tools
- Different glycosylation
Alternative if S. cerevisiae yields insufficient

Purification Strategy for YDR509W:

  • Express with affinity tag (His-tag proven successful )

  • Prepare cell lysate under conditions optimized for YDR509W stability

  • Perform immobilized metal affinity chromatography (IMAC)

  • Include secondary purification step (ion exchange or size exclusion chromatography)

  • Verify purity by SDS-PAGE and Western blotting

  • Confirm protein identity via mass spectrometry

  • Assess proper folding through circular dichroism spectroscopy

The established production of His-tagged YDR509W in E. coli provides a solid starting point , but expression in S. cerevisiae should be considered for functional studies to ensure proper post-translational modifications and protein-protein interactions in the native cellular environment.

What methodological approaches can help overcome common challenges in the recombinant expression of uncharacterized yeast proteins?

Uncharacterized proteins often present unique challenges in recombinant expression. Here are methodological approaches to address these issues:

Challenge: Low Expression Levels

  • Methodological Solution: Employ codon optimization based on host preference

  • Implement: Design synthetic gene with optimized codon adaptation index (CAI)

  • Test multiple promoter systems (constitutive vs. inducible)

  • Evaluate: Quantify expression levels via Western blot and adjust parameters

Challenge: Protein Insolubility/Aggregation

  • Methodological Solution: Fusion protein approach

  • Implement: Test multiple solubility-enhancing tags (MBP, SUMO, GST)

  • Express at lower temperatures (16-20°C)

  • Co-express with molecular chaperones

  • Evaluate: Measure soluble vs. insoluble fraction ratio

Challenge: Protein Instability

  • Methodological Solution: Buffer optimization and stabilizing additives

  • Implement: Systematic screening of buffer conditions (pH, salt, additives)

  • Add protease inhibitors during purification

  • Test stabilizing ligands identified through computational predictions

  • Evaluate: Assess protein half-life under various conditions

Challenge: Unknown Function Complicating Verification

  • Methodological Solution: Activity-independent quality assessment

  • Implement: Thermal shift assays to confirm proper folding

  • Size exclusion chromatography to confirm monomeric/oligomeric state

  • Limited proteolysis to verify structural integrity

  • Evaluate: Compare results to well-characterized proteins of similar size

These approaches take advantage of the extensive toolkit available for recombinant protein production in yeast systems . For YDR509W specifically, the successful expression as a His-tagged protein in E. coli provides a foundation that can be optimized using these methodological solutions .

What bioinformatic approaches should be employed to predict potential functions of YDR509W before experimental validation?

A comprehensive bioinformatic workflow for predicting YDR509W function would encompass:

Sequence-Based Analysis:

  • Homology detection using sensitive profile-based methods (PSI-BLAST, HHpred)

  • Domain architecture identification (SMART, Pfam, InterPro)

  • Sequence motif detection (PROSITE, ELM)

  • Detection of intrinsically disordered regions (PONDR, IUPred)

  • Evolutionary rate analysis compared to characterized yeast proteins

Structural Prediction and Analysis:

  • Secondary structure prediction (PSIPRED, JPred)

  • Tertiary structure prediction (AlphaFold2, RoseTTAFold)

  • Functional site prediction (3DLigandSite, CASTp)

  • Molecular dynamics simulations to assess structural stability

  • Structure-based function prediction (ProFunc, COFACTOR)

Systems-Level Integration:

  • Co-expression analysis across transcriptomic datasets

  • Protein-protein interaction network analysis

  • Phylogenetic profiling across fungal species

  • Genome neighborhood analysis

  • Integration with existing phenotypic data from related genes

This bioinformatic analysis would build on the known properties of YDR509W, such as its 115 amino acid length , and could reveal unexpected relationships to characterized proteins or biological processes. The predictions generated would then guide targeted experimental designs rather than unfocused screening approaches, significantly increasing the efficiency of functional characterization efforts.

How can researchers design experiments to validate bioinformatic predictions about YDR509W function?

To validate bioinformatic predictions about YDR509W function, researchers should implement a structured experimental validation pipeline:

Prediction-Validation Framework:

  • For Predicted Protein-Protein Interactions:

    • Direct validation: Co-immunoprecipitation with predicted partners

    • Proximity-based validation: Bimolecular fluorescence complementation (BiFC)

    • Functional validation: Epistasis analysis between YDR509W and predicted interactors

  • For Predicted Enzymatic Function:

    • Direct biochemical assays with purified recombinant protein

    • Site-directed mutagenesis of predicted catalytic residues

    • Metabolite profiling of knockout vs. wild-type strains under relevant conditions

  • For Predicted Cellular Localization:

    • GFP fusion protein localization studies

    • Subcellular fractionation followed by Western blotting

    • Co-localization studies with known markers

  • For Predicted Regulatory Function:

    • Chromatin immunoprecipitation (ChIP) if DNA-binding predicted

    • Reporter gene assays for predicted regulatory targets

    • RNA immunoprecipitation (RIP) if RNA-binding predicted

Validation Strategy Design Principles:

  • Include appropriate positive and negative controls for each assay

  • Implement orthogonal methods to validate each prediction

  • Design experiments to distinguish between direct and indirect effects

  • Establish quantifiable metrics for validation success

  • Develop clear falsification criteria for each prediction

This methodical approach leverages S. cerevisiae's genetic tractability and the arsenal of molecular biology techniques developed for yeast research , while focusing experimental efforts on the most promising hypotheses generated through bioinformatic analysis.

How can researchers integrate multi-omics data to elucidate the function of uncharacterized proteins like YDR509W?

Integrating multi-omics data requires a systematic approach to connect diverse data types and extract meaningful biological insights about uncharacterized proteins:

Multi-omics Integration Methodology:

  • Data Collection Phase:

    • Generate condition-specific transcriptomics data (RNA-seq) for WT vs. Δydr509w strains

    • Perform quantitative proteomics to identify differentially abundant proteins

    • Conduct metabolomics analysis focusing on primary and secondary metabolites

    • Map genetic interactions through synthetic genetic array (SGA) analysis

    • Identify physical interactions via affinity purification-mass spectrometry (AP-MS)

  • Data Integration Framework:

    • Implement network-based integration using protein-protein interaction networks as a scaffold

    • Apply Bayesian integration methods to weight evidence from different omics layers

    • Utilize dimensionality reduction techniques to identify patterns across datasets

    • Develop custom visualization tools to represent integrated data

  • Functional Inference Process:

    • Apply guilt-by-association principles across integrated networks

    • Identify enriched pathways and processes across all omics layers

    • Detect condition-specific signatures that may reveal contextual function

    • Formulate testable hypotheses based on consistent signals across datasets

This approach would leverage S. cerevisiae's status as one of the best-characterized model organisms , with extensive existing datasets that can complement newly generated data specific to YDR509W. The integration process would help identify conditions or cellular processes where this uncharacterized protein likely functions, narrowing the experimental focus for validation studies.

What are the most promising experimental approaches for investigating potential post-translational modifications of YDR509W?

Post-translational modifications (PTMs) often provide critical insights into protein function. For YDR509W, a systematic investigation of PTMs would involve:

Comprehensive PTM Analysis Strategy:

  • Predictive Analysis:

    • In silico prediction of potential modification sites (phosphorylation, ubiquitination, SUMOylation)

    • Evolutionary conservation analysis of predicted sites across fungal species

    • Structural assessment of site accessibility in predicted protein structure

  • Global PTM Profiling:

    • Phosphoproteomics under various environmental conditions and cell cycle stages

    • Ubiquitin remnant profiling to detect ubiquitination sites

    • SUMO and other UBL-modification site mapping

    • Glycoprofiling if secretion or membrane association is predicted

  • Site-Specific Validation:

    • Generation of point mutants at predicted modification sites

    • Phenotypic characterization of modification site mutants

    • Targeted mass spectrometry to quantify site occupancy

    • Antibody generation against specific modified forms (if feasible)

  • Functional Characterization:

    • Identification of enzymes responsible for modifications (kinases, E3 ligases)

    • Analysis of modification dynamics during stress or cell cycle progression

    • Determination of PTM-dependent protein-protein interactions

    • Assessment of PTM-dependent changes in localization or stability

This methodical approach would be particularly valuable for YDR509W as an uncharacterized protein , as PTMs often regulate protein function, localization, stability, and interactions. The detection of specific modifications could provide crucial clues about cellular pathways involving this protein and guide further functional studies.

What is the significance of studying uncharacterized proteins like YDR509W in S. cerevisiae for broader biotechnology applications?

The study of uncharacterized proteins like YDR509W in S. cerevisiae has far-reaching implications for biotechnology:

Scientific and Biotechnological Significance:

  • Completion of Functional Genomics Knowledge:

    • Despite being one of the best-studied eukaryotes, approximately 20% of S. cerevisiae genes remain uncharacterized

    • Understanding proteins like YDR509W helps complete the functional annotation of this model organism

    • Provides insights into minimal eukaryotic genomes and essential cellular functions

  • Novel Biocatalyst Discovery:

    • Uncharacterized proteins may possess unique enzymatic activities with biotechnological applications

    • Could reveal new biocatalysts for chemical synthesis, bioremediation, or industrial processes

    • Potential applications in metabolic engineering of yeast for production of valuable compounds

  • Protein Engineering Platforms:

    • Newly characterized proteins provide scaffolds for protein engineering

    • May reveal novel protein folds or functional domains

    • Could serve as starting points for synthetic biology applications

  • Improved Heterologous Expression Systems:

    • Understanding yeast proteins improves recombinant protein production platforms

    • Could reveal factors affecting protein folding, modification, or secretion

    • May lead to enhanced yeast strains optimized for biotechnological applications

  • Translational Insights for Human Disease:

    • Many yeast genes have human homologs implicated in disease

    • Characterizing function in yeast provides insights into human cellular processes

    • Can reveal potential drug targets or disease mechanisms

The robust genetic tools available for S. cerevisiae, including efficient homologous recombination and CRISPR/Cas9 systems , make it an ideal platform for uncovering the functions of previously uncharacterized proteins like YDR509W. These discoveries can then be translated into biotechnological applications spanning industrial enzyme production, pharmaceutical manufacturing, and synthetic biology.

How might the characterization of YDR509W contribute to our understanding of eukaryotic cellular biology?

The characterization of YDR509W could advance our understanding of eukaryotic cellular biology in several significant ways:

Potential Contributions to Fundamental Knowledge:

  • Novel Cellular Pathways:

    • YDR509W may participate in previously uncharacterized cellular processes

    • Could reveal regulatory mechanisms unique to eukaryotes

    • Might identify new connections between known cellular pathways

  • Eukaryotic-Specific Functions:

    • As a yeast protein without characterized function or clear orthologs , YDR509W might represent a eukaryotic innovation

    • Characterization could reveal processes that distinguish eukaryotes from prokaryotes

    • May elucidate yeast-specific adaptations relevant to fungal biology

  • Stress Response and Adaptation:

    • Many uncharacterized proteins are involved in specialized stress responses

    • YDR509W could participate in adaptation to specific environmental conditions

    • Might reveal new mechanisms of cellular resilience relevant across eukaryotes

  • Protein Quality Control Systems:

    • Small proteins like YDR509W (115 amino acids ) often function in protein homeostasis

    • Could represent a component of protein folding, trafficking, or degradation pathways

    • Might provide insights into cellular proteostasis mechanisms

  • Gene Expression Regulation:

    • Could function in novel aspects of transcriptional or post-transcriptional regulation

    • Might reveal new mechanisms of chromatin organization or RNA processing

    • Could participate in translation regulation specific to eukaryotes

The study of uncharacterized proteins like YDR509W represents a frontier in molecular biology, with each new functional characterization potentially revealing unexpected aspects of cellular function. S. cerevisiae's position as a model eukaryote means that insights gained from YDR509W could have broad implications for our understanding of conserved cellular processes across the eukaryotic domain.

What are the key methodological challenges in distinguishing the true function of YDR509W from experimental artifacts?

Distinguishing true biological functions from artifacts requires rigorous experimental controls and validation strategies:

Challenge: Overexpression Artifacts

  • Methodological Solution: Implement titratable expression systems

  • Implementation:

    • Replace endogenous promoter with tetracycline-responsive promoter

    • Perform phenotypic analyses across multiple expression levels

    • Correlate phenotypes with protein abundance quantified by Western blot

    • Compare with effects of overexpressing control proteins of similar size/localization

Challenge: Tag Interference with Native Function

  • Methodological Solution: Multi-tag strategy with functional validation

  • Implementation:

    • Generate constructs with tags at both N- and C-termini and internal positions

    • Compare localization patterns and interaction profiles across tag positions

    • Perform complementation assays to verify functionality of tagged proteins

    • Use smallest possible tags (e.g., 3xFLAG instead of GFP where feasible)

Challenge: Off-Target Effects in Genetic Perturbations

  • Methodological Solution: Generate multiple independent mutants with different strategies

  • Implementation:

    • Create knockout strains using different selection markers

    • Implement CRISPR/Cas9 editing with multiple guide RNAs

    • Use complementation with wild-type gene to confirm phenotype rescue

    • Employ conditional alleles to distinguish acute from adaptive effects

Challenge: Indirect Effects in -Omics Analyses

  • Methodological Solution: Time-resolved and epistasis analyses

  • Implementation:

    • Perform time-course experiments after YDR509W perturbation

    • Identify immediate vs. delayed responses in transcriptome and proteome

    • Conduct epistasis experiments with key regulators of affected pathways

    • Use network analysis to distinguish direct from indirect effects

These methodological approaches leverage S. cerevisiae's experimental tractability while implementing rigorous controls to prevent misinterpretation of results when studying an uncharacterized protein like YDR509W .

What experimental design considerations are critical when implementing CRISPR/Cas9 for functional genomics studies of YDR509W?

CRISPR/Cas9 has revolutionized functional genomics in yeast, but requires careful experimental design:

Critical Design Considerations for CRISPR/Cas9 Studies of YDR509W:

  • Guide RNA Selection Strategy:

    • Design multiple gRNAs targeting different regions of YDR509W

    • Score gRNAs for on-target efficiency and off-target potential

    • Consider chromatin accessibility at target sites

    • Avoid sequences with secondary structure that may impair gRNA function

  • Editing Strategy Selection:

    • For knockout: Design repair templates with selection markers

    • For tagging: Ensure tag does not disrupt functional domains

    • For point mutations: Incorporate silent mutations in PAM or seed region to prevent re-cutting

    • For regulatory modifications: Target non-coding regions with minimal predicted off-target effects

  • Control Design:

    • Include non-targeting gRNA controls

    • Generate control strains processed through identical transformation procedures

    • Create revertant strains to confirm phenotype causality

    • Implement rescue experiments with wild-type YDR509W

  • Validation Protocol:

    • PCR and sequencing verification of all engineered loci

    • Verification of expression changes at protein level

    • Whole-genome sequencing to detect off-target modifications

    • Phenotypic comparison across multiple independent clones

  • Experimental Variables to Control:

    • Cas9 expression levels and duration

    • Transformation stress effects

    • Selection pressure during strain construction

    • Growth conditions during phenotypic assessment

S. cerevisiae's efficient homologous recombination capabilities make it particularly amenable to CRISPR/Cas9-based genome editing , but this experimental approach requires careful design and implementation to generate reliable data about uncharacterized proteins like YDR509W .

How should researchers approach comparative genomic analysis to gain insights into YDR509W function across fungal species?

Comparative genomics provides evolutionary context that can illuminate protein function. For YDR509W, a structured approach includes:

Comparative Genomic Analysis Framework:

  • Ortholog Identification Strategy:

    • Employ sensitive sequence similarity searches (PSI-BLAST, HMMer)

    • Verify orthology through reciprocal best hits and synteny analysis

    • Distinguish between orthologs and paralogs through phylogenetic analysis

    • Map presence/absence patterns across fungal species phylogeny

  • Sequence Conservation Analysis:

    • Calculate evolutionary rates across aligned sequences

    • Identify highly conserved residues as potentially functional

    • Map conservation onto predicted protein structure

    • Correlate conservation patterns with predicted functional domains

  • Genetic Context Examination:

    • Analyze gene neighborhood conservation across species

    • Identify co-evolved gene clusters that maintain proximity

    • Detect operon-like structures in fungal genomes

    • Correlate genomic context with metabolic or regulatory pathways

  • Functional Inference from Divergent Species:

    • Compare phenotypes of ortholog mutants in model fungi (S. pombe, C. albicans)

    • Analyze expression patterns of orthologs across conditions and species

    • Identify species-specific adaptations in protein sequence or regulation

    • Correlate protein evolution with ecological niche adaptations

This approach would leverage the extensive genomic data available for fungal species to place YDR509W in an evolutionary context, potentially revealing functional constraints and adaptations that have shaped this protein through evolutionary time. Since YDR509W is uncharacterized , comparative analysis may provide the first clues to its biological role.

What experimental approaches can validate hypotheses derived from evolutionary analysis of YDR509W?

Validating hypotheses from evolutionary analysis requires targeted experimental approaches:

Evolutionary Hypothesis Validation Framework:

  • Cross-Species Complementation:

    • Hypothesis testing approach: Test if orthologs from other species can complement yeast Δydr509w phenotypes

    • Experimental design:

      1. Express orthologs from diverse fungi in S. cerevisiae Δydr509w strain

      2. Quantify rescue of any observed phenotypes

      3. Create chimeric proteins swapping domains between orthologs

      4. Correlate complementation ability with sequence divergence

  • Functionally Critical Residue Validation:

    • Hypothesis testing approach: Verify the importance of evolutionarily conserved amino acids

    • Experimental design:

      1. Perform site-directed mutagenesis of highly conserved residues

      2. Assess effects on protein stability, localization, and function

      3. Compare effects of mutations in conserved vs. variable residues

      4. Correlate mutational effects with evolutionary conservation scores

  • Co-evolution Network Validation:

    • Hypothesis testing approach: Test predicted functional relationships from co-evolution analysis

    • Experimental design:

      1. Identify proteins showing strong co-evolutionary signals with YDR509W

      2. Verify physical interactions through co-immunoprecipitation or proximity labeling

      3. Test genetic interactions through double mutant analysis

      4. Assess co-localization and co-expression patterns

  • Environmental Adaptation Testing:

    • Hypothesis testing approach: Examine function under conditions predicted by species distribution

    • Experimental design:

      1. Test growth and function under conditions mimicking diverse fungal niches

      2. Examine expression patterns across environmental transitions

      3. Compare stress responses between species with and without YDR509W orthologs

      4. Correlate protein function with ecological adaptations of source organisms

These approaches would translate computational predictions from evolutionary analysis into experimentally testable hypotheses. S. cerevisiae's position as a model organism with excellent genetic tools makes it an ideal platform for such validation studies, potentially revealing the function of this uncharacterized protein through evolutionary insights.

What are the most promising research directions for elucidating the function of YDR509W based on current knowledge?

Based on current knowledge and the properties of YDR509W, the following research directions show particular promise:

  • Condition-Specific Functional Screening:

    • Systematic phenotypic analysis of Δydr509w under hundreds of growth conditions

    • Focus on stress conditions and non-optimal growth environments

    • Quantitative fitness measurements using competitive growth assays

    • High-resolution phenotyping using automated image analysis

  • Protein Interaction Mapping:

    • Proximity-dependent biotin labeling (BioID or TurboID) with YDR509W as bait

    • Systematic binary interaction testing against the yeast proteome

    • Dynamic interaction profiling across stress conditions and cell cycle stages

    • Correlation of interaction networks with those of characterized proteins

  • High-Resolution Localization Studies:

    • Super-resolution microscopy of tagged YDR509W

    • Dynamic localization tracking during cell cycle and stress responses

    • Correlation with organelle markers under various conditions

    • Identification of localization-dependent binding partners

  • Integration with Large-Scale Datasets:

    • Mining existing chemical-genetic profiles for YDR509W signatures

    • Analysis of YDR509W expression in single-cell transcriptomic data

    • Correlation with protein abundance changes during environmental transitions

    • Integration with metabolomic signatures from knockout strains

These approaches leverage both the known properties of YDR509W as a small (115 amino acid) protein and the sophisticated experimental tools available for yeast research . The combination of targeted experiments with data integration from large-scale studies offers the best chance of uncovering the biological role of this uncharacterized protein.

How might emerging technologies accelerate the functional characterization of uncharacterized proteins like YDR509W?

Emerging technologies are poised to revolutionize the characterization of uncharacterized proteins:

Transformative Methodologies on the Horizon:

  • AI-Driven Structural and Functional Prediction:

    • AlphaFold and similar AI tools for accurate structural prediction

    • Integration of structural predictions with molecular dynamics simulations

    • Machine learning approaches to predict function from structure

    • Network-based AI tools to predict cellular pathways and interactions

  • High-Throughput CRISPR Screening Advances:

    • Massively parallel CRISPR-based functional genomics

    • Single-cell CRISPR screens with transcriptomic readouts

    • CRISPR interference/activation screens for gene regulation studies

    • Combinatorial CRISPR screens to map genetic interactions

  • Single-Cell Multi-Omics Integration:

    • Simultaneous profiling of transcriptome, proteome, and metabolome at single-cell resolution

    • Spatial transcriptomics and proteomics to map molecular distributions

    • Temporal single-cell profiling during environmental transitions

    • Integration of single-cell data with computational modeling

  • Advanced Protein Engineering Tools:

    • Split protein complementation systems for interaction mapping

    • Optogenetic and chemogenetic tools for temporal control of protein function

    • Expanded genetic code incorporation for site-specific chemical biology

    • Engineered biosensors to detect protein activity in vivo

  • Microfluidics and Lab-on-Chip Technologies:

    • High-throughput phenotypic screening in microfluidic devices

    • Single-cell isolation and analysis systems

    • Continuous culture systems with precise environmental control

    • Miniaturized biochemical assay platforms

These technologies would dramatically accelerate the characterization of uncharacterized proteins like YDR509W , particularly when combined with S. cerevisiae's genetic tractability and extensive knowledge base . The integration of computational predictions with high-throughput experimental validation offers a powerful path forward for completing our understanding of the yeast proteome and, by extension, fundamental eukaryotic cellular processes.

What standardized protocols should be followed for the recombinant production and purification of YDR509W for structural studies?

Standardized Protocol for YDR509W Production and Purification:

Expression System Preparation:

  • Transform E. coli BL21(DE3) with expression vector containing His-tagged YDR509W

  • Select transformants on appropriate antibiotic-containing media

  • Prepare glycerol stocks of verified expression strains

Expression Protocol:

  • Inoculate 10 mL LB medium with antibiotic from glycerol stock, grow overnight at 37°C

  • Dilute 1:100 into 1L expression medium (Terrific Broth recommended)

  • Grow at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.5 mM IPTG

  • Shift temperature to 18°C and continue expression for 18 hours

  • Harvest cells by centrifugation (5,000 × g, 15 minutes, 4°C)

  • Wash cell pellet with PBS and store at -80°C if not used immediately

Cell Lysis and Clarification:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, 5% glycerol, protease inhibitor cocktail)

  • Lyse cells by sonication (6 cycles of 30 seconds on/30 seconds off)

  • Clarify lysate by centrifugation (20,000 × g, 30 minutes, 4°C)

  • Filter supernatant through 0.45 μm membrane

Purification Procedure:

  • IMAC Purification:

    • Equilibrate Ni-NTA column with binding buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

    • Load filtered lysate onto column

    • Wash with 10 column volumes of wash buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole)

    • Elute protein with elution buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole)

  • Size Exclusion Chromatography:

    • Concentrate IMAC eluate using 3 kDa MWCO concentrator

    • Load onto Superdex 75 column equilibrated with SEC buffer (20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT)

    • Collect fractions and analyze by SDS-PAGE

Quality Control Assessment:

  • Verify protein identity by mass spectrometry

  • Assess purity by SDS-PAGE (target >95% purity)

  • Measure concentration by Bradford assay and A280 measurement

  • Evaluate monodispersity by dynamic light scattering

  • Verify proper folding by circular dichroism spectroscopy

This standardized protocol builds on the established production of His-tagged YDR509W in E. coli and incorporates best practices for recombinant protein production for structural studies.

How can researchers design controlled experiments to distinguish the effects of YDR509W deletion from compensation mechanisms?

Distinguishing direct effects from compensatory responses requires careful experimental design:

Experimental Design Framework for Discriminating Direct vs. Compensatory Effects:

  • Temporal Analysis Approach:

    • Experimental design:

      1. Implement an inducible degradation system (e.g., auxin-inducible degron tag)

      2. Monitor cellular responses at multiple timepoints post-induction (5 min, 30 min, 2 h, 24 h)

      3. Compare acute (early) vs. chronic (late) responses through transcriptomics and proteomics

      4. Identify immediate responses likely representing direct effects of YDR509W loss

  • Dosage-Dependent Analysis:

    • Experimental design:

      1. Generate strains with varying levels of YDR509W expression (0-200% of wild-type)

      2. Quantify phenotypic responses across the expression spectrum

      3. Identify thresholds where compensatory mechanisms activate

      4. Plot dose-response curves to distinguish linear (direct) vs. non-linear (compensatory) effects

  • Genetic Background Manipulation:

    • Experimental design:

      1. Delete YDR509W in multiple strain backgrounds with different capacities for compensation

      2. Compare phenotypes across genetic backgrounds

      3. Delete YDR509W in strains lacking key stress response pathways

      4. Identify genetic interactions that prevent compensatory adaptation

  • Environmental Perturbation Strategy:

    • Experimental design:

      1. Analyze Δydr509w under normal conditions vs. rapid environmental shifts

      2. Compare growth during steady-state vs. transitional conditions

      3. Measure cellular responses before compensation can occur

      4. Identify conditions that reveal phenotypes masked by compensation

  • Multi-omics Integration Approach:

    • Experimental design:

      1. Simultaneously measure transcriptome, proteome, and metabolome changes

      2. Identify discordant responses indicating compensatory regulation

      3. Model regulatory networks to distinguish primary from secondary effects

      4. Validate model predictions through targeted perturbations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.