Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR521W (YDR521W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YDR521W; Putative uncharacterized protein YDR521W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR521W
Target Protein Sequence
MKGSKSHLVFTLLQVSQLNVFLFFLGFLLPLFLGLFVSLRSLALALSSGWFIMDLILFRT FPEAELYPAVIGKPSGLGLTEAFEFISIFFPDVQQTERNIKYNWERCFNGE
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the YDR521W locus in Saccharomyces cerevisiae?

YDR521W is a locus in the Saccharomyces cerevisiae genome that encodes a putative uncharacterized protein. The reference genome sequence for this locus is derived from the laboratory strain S288C, which serves as the standard reference for yeast genomic studies . The Saccharomyces Genome Database (SGD) maintains sequence information for this locus, including genomic context and coordinates that researchers can download for further analysis . While the protein is classified as "putative uncharacterized," this designation indicates that computational methods predict the region encodes a protein, but experimental validation of its expression and function remains limited. Researchers approaching this protein should begin with sequence analysis tools to predict potential domains, structural features, and possible functions based on homology to characterized proteins in other organisms.

How can I access genomic data for YDR521W for comparative analysis?

To access genomic data for comparative analysis of YDR521W, researchers should utilize the Saccharomyces Genome Database (SGD), which provides comprehensive information about this locus. The database offers DNA and protein sequences derived from the reference strain S288C, as well as sequence variations found in other strains . Researchers can download these sequences in various formats suitable for bioinformatic analyses. The SGD also provides genomic context information that shows neighboring genes and their orientations, which can be valuable for understanding potential regulatory relationships or operon structures. For comparative genomics approaches, researchers should utilize BLAST functionality available through the SGD platform to identify homologs in related species . When conducting comparative analyses, it's important to consider both sequence conservation and synteny (preservation of gene order) across different yeast species, as these can provide insights into evolutionary conservation and functional importance.

What are the fundamental techniques for expressing recombinant YDR521W protein?

Expressing recombinant YDR521W protein requires a systematic approach beginning with vector construction. First, the YDR521W coding sequence should be PCR-amplified from S. cerevisiae genomic DNA with primers containing appropriate restriction sites. The amplified sequence can then be cloned into an expression vector carrying a strong promoter (such as GAL1 for inducible expression) and appropriate selection markers . For homologous expression within S. cerevisiae, vectors based on yeast episomal plasmids (YEps) or yeast integrative plasmids (YIps) can be used.

For optimal expression, consider these methodological steps:

  • Codon optimization if expressing in a heterologous host

  • Addition of affinity tags (His, FLAG, etc.) for purification and detection

  • Selection of appropriate host strain (protease-deficient strains may improve yield)

  • Optimization of culture conditions using Design of Experiments (DoE) approach

The DoE approach is particularly valuable as it allows systematic identification of optimal expression conditions by testing multiple factors simultaneously rather than the inefficient one-factor-at-a-time method . For instance, a factorial design can be used to determine the effects of temperature, induction time, and media composition on protein yield, helping to identify significant interaction effects that might be missed in traditional approaches.

How can I apply meiotic segregation techniques to study YDR521W function?

Meiotic segregation can be a powerful approach for studying YDR521W function, particularly through creating hybrid strains with phenotypic diversity. This methodology leverages the natural process of meiosis to generate genetic variation that can reveal the functional implications of YDR521W. Begin by creating an artificial tetraploid interspecies hybrid between S. cerevisiae strains with different YDR521W alleles or between S. cerevisiae and a related species like S. eubayanus . The resulting hybrid should be induced to sporulate, producing haploid spore clones that will contain different combinations of chromosomes and alleles.

For methodological implementation:

  • Create the hybrid strain through rare mating techniques between haploid S. cerevisiae strains carrying different YDR521W alleles

  • Induce sporulation in nutrient-poor media (typically 1% potassium acetate)

  • Isolate complete tetrads and dissect spores using micromanipulation

  • Screen spore clones for phenotypic diversity related to potential YDR521W functions

  • Perform whole-genome sequencing to determine which spore clones retained which version of YDR521W

This approach has been successfully used with other yeast proteins, where F1 spore clones from a single ascus exhibited significant phenotypic diversity in various traits . The phenotypic differences among spore clones carrying different YDR521W alleles can provide insights into the protein's function. Further generations (F2, F3) can be produced to refine observations, as demonstrated in studies where F2 clones showed improved characteristics compared to both F1 parents and original hybrid strains .

What genomic instability concerns should be considered when working with recombinant YDR521W strains?

When working with recombinant YDR521W strains, genomic instability represents a significant concern that can impact experimental reproducibility and interpretation. Polyploid interspecific hybrids, which might be created during YDR521W functional studies, are particularly prone to genomic instability . This instability manifests as variations in ploidy, chromosome copy numbers, and structural variations (SVs) that can emerge during cultivation and meiosis.

Methodological approaches to address these concerns include:

  • Regular karyotyping of strains through flow cytometry to monitor ploidy levels

  • Genomic sequencing after key experimental steps to detect structural variations

  • Implementation of split and discordant read analysis to identify deletions, duplications, and translocations

  • Single-cell isolation after consecutive batch fermentations to assess genetic drift

Research has demonstrated that hybrid yeast strains can develop numerous structural variations, including deletions, insertions, inversions, duplications, and translocations . For instance, one study detected 94 heterozygous SVs in a parent strain, including 67 deletions and 27 insertions . When working with YDR521W recombinant strains, it's critical to recognize that even without selective pressure, genetic instability can lead to phenotypic changes unrelated to the target protein's function.

During consecutive batch cultures, strains may exhibit significant variation in chromosome copy numbers, highlighting the need for genetic monitoring throughout experiments . This instability should be considered when interpreting phenotypic changes, as they may result from genetic alterations beyond the YDR521W locus.

How can heterozygous SNPs in YDR521W be phased for haplotype reconstruction?

Phasing heterozygous SNPs in YDR521W for accurate haplotype reconstruction requires a combination of next-generation sequencing technologies and computational approaches. This process is essential for understanding allele-specific effects of YDR521W variants and for creating reference genomes for hybrid strain analysis.

The methodological workflow should include:

  • Generate both short-read (Illumina) and long-read (Oxford Nanopore or PacBio) sequencing data from the strain of interest

  • Map short reads to a reference genome and call variants using a tool like FreeBayes

  • Map long reads to the same reference using minimap2 with parameters optimized for the specific sequencing platform used

  • Use WhatsHap or similar phasing software that can leverage long reads spanning multiple heterozygous sites to determine haplotypes

  • Extract the phased haplotypes from the resulting VCF files

This approach has been successfully applied to S. cerevisiae strains with heterozygosity rates around 0.23%, where approximately 90% of heterozygous SNPs were successfully phased into distinct blocks . The resulting haplotypes can then be used as more accurate references for analyzing the effects of specific YDR521W alleles.

For optimal results, ensure that long-read coverage is sufficient (>30x) to span regions with multiple heterozygous sites. The quality of phasing is directly related to the length of reads, with longer reads providing more accurate haplotype reconstruction. After phasing, validate the reconstructed haplotypes by amplifying and sequencing specific regions or by analyzing segregation patterns in progeny if conducting breeding experiments.

How can I optimize experimental conditions for YDR521W expression using Design of Experiments (DoE)?

Optimizing YDR521W expression requires a systematic approach that accounts for multiple interacting factors. Design of Experiments (DoE) methodology offers significant advantages over traditional one-factor-at-a-time approaches by efficiently identifying optimal conditions with fewer experiments while capturing interaction effects .

For YDR521W expression optimization, implement the following DoE methodology:

  • Factor Identification: Select 3-5 key factors likely to affect expression, such as:

    • Temperature (20-30°C)

    • Induction time (4-24 hours)

    • Inducer concentration (0.1-2% galactose for GAL promoters)

    • Media composition (carbon source variations)

    • Host strain background

  • Experimental Design Selection: Choose an appropriate design based on your research questions:

    • Fractional factorial design for screening many factors with fewer runs

    • Response surface methodology (RSM) for finding optimal conditions

    • Central composite design for modeling curved responses

  • Data Collection: Measure relevant responses:

    • Protein yield (quantified by Western blot or activity assay)

    • Solubility percentage

    • Functional activity if an assay is available

  • Statistical Analysis: Analyze results using appropriate software to:

    • Identify significant main effects and interactions

    • Generate predictive models

    • Identify optimal conditions through contour plots or response surface graphs

This approach offers significant advantages over traditional methods by capturing interaction effects that might otherwise be missed. For example, optimal temperature for expression might depend on media composition, an interaction that one-factor-at-a-time approaches would not detect.

Several software packages can facilitate DoE implementation, statistical analysis, and visualization of results, making this approach accessible even to researchers without extensive statistical training . By applying DoE methodology, you can identify optimal conditions for YDR521W expression with a minimal number of experiments, reducing cost and time while improving protein yield and quality.

What qualitative research approaches complement quantitative methods in studying YDR521W function?

While quantitative approaches provide measurable data on YDR521W's biochemical properties, complementary qualitative research methods can provide deeper contextual understanding and guide hypothesis development. Qualitative approaches are particularly valuable when exploring uncharacterized proteins where function may not be immediately apparent through traditional assays.

Methodological integration of qualitative approaches should include:

  • Theoretical Framing: Establish a clear epistemological position to guide your research questions and interpretations of YDR521W's potential functions

  • Observational Studies: Document cellular responses to YDR521W manipulation through:

    • Time-lapse microscopy with detailed field notes on morphological changes

    • Systematic observation of growth patterns under various conditions

    • Documentation of unexpected phenotypes for further investigation

  • Case Study Approaches: Develop detailed analysis of specific conditions where YDR521W appears functionally important:

    • Compare wild-type and knockout strains under various stressors

    • Analyze specific mutant phenotypes in detail

    • Document context-dependent protein behaviors

  • Integrated Data Collection: Combine methods to triangulate findings:

    • Laboratory notebooks with detailed observations

    • Visual documentation of cellular phenomena

    • Iterative experimental design based on emerging observations

The qualitative data collection process should be methodologically rigorous, with researchers documenting their positionality and potential biases regarding expected functions . This integration of approaches creates a robust research design that can identify subtle phenotypes easily missed by purely quantitative approaches.

Effective qualitative research complements quantitative data by providing context, suggesting new hypotheses for testing, and identifying conditions where YDR521W's function becomes apparent. This mixed-methods approach is particularly valuable for uncharacterized proteins where standard assays may not immediately reveal function.

How should I approach structural variation analysis in S. cerevisiae strains expressing modified YDR521W?

Structural variation (SV) analysis is critical when working with modified YDR521W strains, as genetic manipulations can lead to unintended structural changes that affect phenotype interpretation. A comprehensive SV detection approach combines complementary technologies and analytical methods to identify various types of genomic rearrangements.

Implement the following methodological workflow:

  • Long-read sequencing: Generate Oxford Nanopore or PacBio long reads covering the entire genome

    • Use Sniffles or similar tools specifically designed for SV detection from long reads

    • Look for deletions, insertions, inversions, duplications, and translocations

  • Short-read sequencing: Generate paired-end Illumina reads as complementary data

    • Use LUMPY through smoove pipeline to detect SVs from split and discordant reads

    • Focus on identifying smaller SVs that might be missed by long reads

  • Integrated analysis: Cross-validate findings from both approaches

    • Compare SV calls between parent strains and YDR521W-modified strains

    • Distinguish pre-existing from de novo SVs that may have resulted from genetic manipulation

  • Functional annotation: Assess the potential impact of detected SVs

    • Analyze affected genes using GO term enrichment analysis

    • Pay particular attention to SVs affecting cell wall components, extracellular regions, and membrane components which are frequently affected in yeast SVs

When analyzing strain stability, implement time-course experiments with sampling at multiple generations to detect emerging SVs. Research has shown that following manipulation, yeast strains can develop numerous SVs including dozens of deletions, insertions, and translocations . It's essential to determine whether observed phenotypes result from YDR521W modification or from secondary SVs that may have emerged during strain construction or cultivation.

The detection sensitivity varies by SV type and technology, so combining approaches provides more comprehensive results. For example, long reads excel at detecting large inversions and complex rearrangements, while short-read approaches may better identify smaller insertions and deletions.

What bioinformatic pipelines are most effective for analyzing YDR521W function based on sequence data?

For comprehensive analysis of the uncharacterized YDR521W protein, an integrated bioinformatic pipeline combining multiple predictive approaches provides the most robust functional insights. This methodological framework moves beyond basic homology searches to incorporate structural prediction, functional domain analysis, and evolutionary conservation patterns.

Implement the following bioinformatic workflow:

  • Sequence-based analysis:

    • Position-Specific Iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Hidden Markov Model (HMM) searches against Pfam and other domain databases

    • Analysis of conserved motifs using MEME Suite

    • Prediction of post-translational modification sites

  • Structural prediction and analysis:

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Active site prediction based on structural features

    • Protein-protein interaction surface prediction

    • Molecular dynamics simulations to assess structural stability

  • Evolutionary analysis:

    • Ortholog identification across fungal species

    • Positive/negative selection analysis using PAML

    • Synteny analysis to identify conserved genomic contexts

    • Phylogenetic profiling to identify co-evolving genes

  • Integration with experimental data:

    • Correlation with available transcriptomic data

    • Analysis of protein-protein interaction networks

    • Incorporation of phenotypic data from knockout/knockdown studies

    • Prediction of subcellular localization

The most effective approach combines these computational predictions with targeted experimental validation. For instance, if structural prediction suggests a potential enzymatic active site, directed mutagenesis of predicted catalytic residues can test this hypothesis. Similarly, if evolutionary analysis shows conservation only under specific conditions, experimental testing under those conditions may reveal function.

This integrated pipeline has successfully identified functions for previously uncharacterized proteins by leveraging multiple layers of evidence rather than relying on any single predictive method. For YDR521W, this approach can generate testable hypotheses about protein function that guide subsequent experimental design.

What ethical considerations should guide genetic manipulation of YDR521W in S. cerevisiae?

When conducting genetic manipulation of YDR521W in S. cerevisiae, researchers must navigate several ethical considerations that extend beyond basic laboratory safety protocols. As an established model organism, S. cerevisiae research typically raises fewer ethical concerns than work with higher organisms, but responsible research practices remain essential.

The methodological approach to ethical research should include:

While S. cerevisiae is generally recognized as safe (GRAS), modified strains with enhanced capabilities might present new considerations, particularly if YDR521W modification confers fitness advantages or novel metabolic capabilities. Researchers should engage in ongoing ethical deliberation as the function of YDR521W becomes better understood, particularly if findings suggest applications beyond basic research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.