Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR526C (YDR526C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, please specify any format requirements in your order notes; we will fulfill your request whenever possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments default to standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
YDR526C; Putative uncharacterized protein YDR526C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR526C
Target Protein Sequence
MPCLLPPTQVPEAPSISANNGVLFSSFALLFMFFNSLAISLGSKELYRSSRSCTICSSLI PCRTLIFSLWIDFASDSGASVLVCCFSASLPLVFFFWALFSLSLSFQDDIFLGLYNSGNP VPQLLVLRVPLSLLSTESDVSFSTISPSKSITMVAE
Uniprot No.

Target Background

Database Links

STRING: 4932.YDR526C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YDR526C and what is currently known about this putative uncharacterized protein?

YDR526C is a putative uncharacterized protein from the yeast Saccharomyces cerevisiae with a full length of 156 amino acids. It is classified as "putative uncharacterized" because its biological function has not been fully elucidated through experimental validation. The protein is available as a recombinant protein expressed in E. coli with a His-tag for research purposes .

Currently, limited information exists regarding its specific molecular function, biological processes, or cellular localization. Like many uncharacterized proteins in the yeast proteome, YDR526C represents a knowledge gap in our understanding of yeast cellular biology. Genome-wide studies have identified its existence, but targeted research to characterize its function remains limited in the published literature.

What experimental design considerations are essential when studying an uncharacterized protein like YDR526C?

When designing experiments to study YDR526C, researchers should implement a systematic approach following these key considerations:

  • Define clear variables - Establish independent variables (what you're manipulating) and dependent variables (what you're measuring) with precise operational definitions .

  • Control for confounding variables - Identify and control extraneous variables that could influence your results .

  • Establish appropriate controls - Both positive and negative controls are essential for comparison and validation.

  • Select appropriate experimental systems:

    Experimental ApproachApplication to YDR526CAdvantages
    Between-subjects designCompare wild-type vs. YDR526C deletion strainsControls for individual variations
    Within-subjects designSame strain under different conditionsReduces sample variability
    Factorial designTest multiple variables simultaneouslyReveals interaction effects
  • Ensure statistical power - Run at least three independent experiments to establish reproducibility and statistical significance .

  • Plan for validation - Include methods to validate initial findings through orthogonal approaches .

Remember that a good experimental design requires a strong understanding of the biological system and should allow for systematic testing of your hypothesis about YDR526C function .

How can recombinant YDR526C protein be effectively expressed and purified for functional studies?

Effective expression and purification of recombinant YDR526C requires careful consideration of expression systems, purification strategies, and quality control:

Expression Systems Selection:

E. coli is the most commonly used host for recombinant protein production due to its relative simplicity, inexpensive and fast high-density cultivation, well-known genetics, and large number of compatible molecular tools . For YDR526C specifically, E. coli expression has been documented with His-tagging .

Expression Protocol:

  • Clone the YDR526C gene into an expression vector under the control of an inducible promoter like T7 or tac

  • Transform the construct into an appropriate E. coli strain (BL21(DE3) is commonly used)

  • Optimize expression conditions:

    • Temperature: Lower temperatures (15-30°C) can improve folding and reduce inclusion body formation

    • Induction timing: Typically at mid-log phase

    • Inducer concentration: Titrate for optimal expression

Purification Strategy for His-tagged YDR526C:

  • Cell lysis: Sonication or mechanical disruption in appropriate buffer

  • Affinity chromatography: Using Ni-NTA resin to capture His-tagged YDR526C

  • Washing: Remove non-specifically bound proteins

  • Elution: Using imidazole gradient or pH change

  • Further purification: Size exclusion chromatography if needed

  • Quality assessment: SDS-PAGE, Western blot, mass spectrometry

Common Challenges and Solutions:

  • Poor solubility: Consider using solubility enhancers like fusion tags (MBP, SUMO, TRX)

  • Low yield: Optimize codon usage for E. coli or try alternative expression hosts

  • Improper folding: Co-express with molecular chaperones or use lower expression temperatures

What are the critical factors affecting successful expression of recombinant YDR526C in E. coli?

Several critical factors can significantly influence the successful expression of recombinant YDR526C in E. coli:

Genetic Factors:

  • Codon optimization: Rare codons in YDR526C can cause translational pausing and reduced protein yield. There are two experimental solutions: (1) increase the amount of appropriate cognate tRNA, or (2) alter these codons to frequently used E. coli codons .

  • Promoter strength: Strong promoters may lead to inclusion body formation, while weak promoters may yield insufficient protein .

  • Gene copy number: Dependent on plasmid copy number, which affects gene dosage and potential metabolic burden .

Expression Conditions:

  • Temperature: Lower temperatures (15-30°C) slow protein synthesis, allowing proper folding and reducing inclusion body formation .

  • Induction parameters: Timing, duration, and inducer concentration affect yield and solubility.

  • Media composition: Rich vs. minimal media impacts growth rate and protein expression.

  • pH: Can affect proteolytic activity, secretion, and protein production levels .

Protein-Specific Factors:

  • Protein toxicity: If YDR526C has toxic effects on E. coli, consider using tightly regulated expression systems.

  • Stability: N- and C-terminal sequences can affect protease susceptibility .

  • mRNA stability: Secondary structures at 5' and 3' ends can protect mRNA from degradation .

Fusion Strategies:

  • Solubility tags: Tags like MBP, GST, or SUMO can enhance solubility .

  • Purification tags: His6 tag facilitates purification via Ni-NTA chromatography .

  • Signal sequences: For potential periplasmic expression to reduce cytoplasmic proteolysis .

FactorEffect on ExpressionOptimization Strategy
TemperatureLower temperatures reduce inclusion bodiesUse 15-30°C during induction phase
PromoterToo strong can lead to aggregationUse tunable promoters (e.g., tac or T7lac)
Host strainDifferent strains have different capabilitiesTest BL21(DE3), Rosetta, or Origami strains
Codon usageRare codons reduce expressionUse codon-optimized gene or Rosetta strains
Growth phaseAffects cell physiologyInduce at mid-log phase (OD600 0.4-0.8)

How can protein-protein interaction studies help elucidate the function of YDR526C?

Protein-protein interaction (PPI) studies are powerful approaches for understanding the function of uncharacterized proteins like YDR526C by revealing their binding partners and potential involvement in cellular pathways:

Methodological Approaches:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Clone YDR526C as a bait protein fused to a DNA-binding domain

    • Screen against a yeast prey library fused to an activation domain

    • Interaction activates reporter gene expression

    • Follow-up with targeted Y2H to confirm specific interactions

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged YDR526C in yeast cells

    • Lyse cells under non-denaturing conditions

    • Pull down YDR526C and associated proteins using tag-specific antibodies

    • Identify binding partners by mass spectrometry

  • Affinity Purification coupled with Mass Spectrometry (AP-MS):

    • Express tagged YDR526C in yeast

    • Perform tandem affinity purification

    • Identify co-purified proteins by mass spectrometry

    • Filter against common contaminants

  • Proximity-Based Labeling:

    • Fuse YDR526C with BioID or APEX2

    • These enzymes biotinylate nearby proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Protein Complementation Assays:

    • Split reporter protein (e.g., split-GFP, split-luciferase)

    • Fuse fragments to YDR526C and candidate partner

    • Interaction restores reporter activity

Interpretation of PPI Data:

PPI networks for uncharacterized proteins like YDR526C can reveal functional associations. The set of interaction pairs discovered through such studies often overlaps significantly with known protein-protein interaction networks and genetic interaction pairs . Analysis of these networks can identify:

  • Functional modules: Groups of interacting proteins involved in the same biological process

  • Pathway membership: Association with proteins of known function

  • Subcellular localization: Interaction with proteins of known localization

  • Disease relevance: Connection to pathways implicated in disease states

When interpreting PPI data for YDR526C, it's essential to validate interactions through multiple independent methods and to consider the biological context of detected interactions.

How can dosage suppression analysis be applied to understand YDR526C function?

Dosage suppression analysis is a powerful genetic approach for understanding the function of uncharacterized proteins like YDR526C, particularly in yeast where this methodology is well-established:

Conceptual Framework:

Dosage suppression occurs when overexpression of one gene suppresses the phenotypic effects of a mutation in another gene. This genetic relationship often indicates functional connection between the two genes, such as:

  • Physical interaction between proteins

  • Involvement in the same biological pathway

  • Regulatory relationships

  • Participation in parallel redundant pathways

Methodological Approach for YDR526C:

  • Create conditional mutant strains:

    • Generate temperature-sensitive or conditional YDR526C mutants

    • Characterize the resulting phenotypes (growth defects, stress sensitivity, etc.)

  • Perform genome-wide screening:

    • Transform mutant strains with an overexpression library (e.g., yeast ORF collections)

    • Select for transformants that rescue the mutant phenotype

    • Identify suppressor genes through plasmid isolation and sequencing

  • Validation and characterization:

    • Confirm suppression through targeted transformation

    • Quantify the degree of suppression

    • Characterize specificity through testing multiple mutant strains

  • Network analysis:

    • Construct a dosage suppressor network

    • Identify patterns of suppression

    • Compare with other genetic and physical interaction networks

Data Interpretation:

Genome-wide dosage suppressor screens in yeast have revealed extensive networks of genetic interactions. For example, in one study, a screen of 53 conditional lethal mutations revealed 660 suppressor interactions, of which 642 were novel . These networks showed distinctive features, including:

  • High co-occurrence of mutant-suppressor pairs within protein modules

  • Highly correlated functions between the pairs

  • Higher diversity of functions among co-suppressors than previously observed

When applied to YDR526C, dosage suppression analysis could reveal:

  • Proteins that physically interact with YDR526C

  • Parallel pathways that can compensate for YDR526C function

  • Downstream effectors in the same pathway

  • Regulatory relationships

These findings would provide crucial insights into the biological context and function of this uncharacterized protein.

What transcriptomic approaches can help define the function of YDR526C in cellular processes?

Transcriptomic approaches provide valuable insights into the function of uncharacterized proteins like YDR526C by examining their expression patterns and transcriptional responses:

RNA-Seq Analysis of YDR526C Deletion/Overexpression:

  • Differential Expression Analysis:

    • Compare transcriptome profiles between wild-type and YDR526C deletion strains

    • Identify genes whose expression changes significantly upon YDR526C manipulation

    • Perform similar analysis with YDR526C overexpression strains

    • Cross-reference differentially expressed genes with known pathways

  • Condition-Specific Expression:

    • Analyze YDR526C expression under various growth conditions and stresses

    • Identify conditions where YDR526C is strongly induced or repressed

    • Compare expression patterns with genes of known function

Transcription Factor Binding Analysis:

  • ChIP-Seq for Transcription Factors:

    • Identify transcription factors that bind to the YDR526C promoter

    • Determine if YDR526C itself has DNA-binding properties using ChIP-Seq

    • Analyze transcription factor binding sites in the YDR526C promoter

  • Motif Analysis:

    • Identify potential regulatory motifs in YDR526C promoter

    • Compare with genes showing similar expression patterns

Co-expression Network Analysis:

Superparamagnetic clustering algorithms can be modified to identify genes co-regulated with YDR526C. One approach is to add an extra weight to the interaction formula that considers which genes are regulated by the same transcription factors . This combined similarity measure relies on:

  • Expression profiles generated by microarray data

  • The number of shared transcription factors experimentally proven to bind to gene promoters

This modified approach (SPCTF) has been successfully applied to analyze cell cycle genes in yeast, finding clusters with higher numbers of elements compared to standard methods .

Validation Through RT-qPCR:

For specific gene expression analysis, quantitative RT-PCR can verify expression changes in selected genes upon YDR526C deletion:

  • Extract total RNA from wild-type and YDR526C deletion strains

  • Perform reverse transcription to generate cDNA

  • Use real-time quantitative PCR with primers specific to genes of interest

  • Normalize to a control gene like ACT1

Transcriptomic analysis not only reveals the expression pattern of YDR526C but also identifies genes and pathways that are functionally connected to it, providing crucial clues about its biological role.

What computational approaches can predict the function of uncharacterized proteins like YDR526C?

Computational approaches offer valuable insights into the potential functions of uncharacterized proteins like YDR526C when experimental data is limited:

Sequence-Based Approaches:

  • Homology-Based Function Prediction:

    • BLAST/PSI-BLAST searches against annotated protein databases

    • Identification of remote homologs using Hidden Markov Models (HMMs)

    • Multiple sequence alignment to identify conserved residues

  • Domain and Motif Analysis:

    • Search for known functional domains using InterPro, Pfam, SMART

    • Identify sequence motifs associated with specific functions

    • Analyze protein composition and complexity

  • Evolutionary Analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Synteny analysis across fungal genomes

    • Evolutionary rate analysis (conserved proteins often have essential functions)

Structure-Based Approaches:

  • Structural Prediction:

    • Ab initio protein structure prediction using AlphaFold2 or RoseTTAFold

    • Homology modeling if structural homologs exist

    • Analysis of predicted binding pockets and active sites

  • Structural Comparison:

    • Comparison with structurally characterized proteins

    • Identification of structural motifs associated with specific functions

    • Surface electrostatics and hydrophobicity analysis

Network-Based Approaches:

  • Guilt by Association:

    • Integration of protein-protein interaction data

    • Co-expression network analysis

    • Genetic interaction network analysis

  • Pathway Enrichment:

    • Identification of pathways enriched with YDR526C interactors

    • Analysis of metabolic network context

    • Integration with phenotypic data

Machine Learning Approaches:

  • Function Prediction Algorithms:

    • Support Vector Machines for protein function classification

    • Random Forests for integrating heterogeneous data

    • Deep learning approaches using protein encodings

  • Feature Extraction:

    • Biochemical properties (hydrophobicity, charge, etc.)

    • Evolutionary features (conservation scores, substitution rates)

    • Expression patterns across conditions

Computational Workflow for YDR526C:

Computational ApproachTools/ResourcesExpected Outcome
Sequence homologyBLAST, HHpredIdentification of related proteins
Domain analysisInterPro, PfamPotential functional domains
Structural predictionAlphaFold23D structure prediction
Protein-protein interactionSTRING, BioGRIDInteraction network context
Co-expression analysisSPELL, COEXCo-regulated genes
Pathway analysisKEGG, GO enrichmentBiological process involvement
Subcellular localizationDeepLoc, YLocCellular compartment prediction

By integrating these diverse computational approaches, researchers can generate testable hypotheses about the function of YDR526C that can guide subsequent experimental validation.

What phenotypic assays are most informative for characterizing YDR526C mutants?

Phenotypic assays provide crucial insights into the function of uncharacterized proteins by revealing the consequences of their deletion, mutation, or overexpression:

Growth-Based Phenotypic Assays:

  • Conditional Growth Assays:

    • Test growth of YDR526C deletion strains under various conditions:

      • Temperature sensitivity (15°C, 30°C, 37°C, 42°C)

      • Media variation (rich vs. minimal media)

      • Carbon source utilization (glucose, galactose, glycerol, ethanol)

      • Nitrogen source utilization

    • Quantify growth rates and lag phases using automated growth analyzers

  • Stress Response Assays:

    • Expose YDR526C mutants to different stressors:

      • Oxidative stress (H₂O₂, menadione)

      • Osmotic stress (high salt, sorbitol)

      • Cell wall stress (calcofluor white, Congo red)

      • DNA damage agents (UV, MMS, hydroxyurea)

      • Heavy metals (copper, cadmium)

    • Determine minimum inhibitory concentrations and growth inhibition zones

  • Drug Sensitivity Screens:

    • Test sensitivity to various chemotherapeutic and antifungal agents

    • Compare with known pathway mutants to identify potential functional relationships

    • This approach has been successful in identifying genetic variation in response to chemotherapy and cancer chemoprevention drugs in yeast

Cellular and Molecular Phenotypes:

  • Cell Morphology Analysis:

    • Microscopic examination of cell size, shape, and budding patterns

    • Cell wall integrity tests

    • Vacuolar morphology using specific dyes

  • Cell Cycle Analysis:

    • Flow cytometry to assess DNA content and cell cycle distribution

    • Synchronization experiments to identify cell cycle-specific defects

    • Spindle morphology assessment using tubulin markers

  • Protein Localization and Trafficking:

    • Fluorescent tagging of YDR526C to determine subcellular localization

    • Co-localization with organelle markers

    • Analysis of protein trafficking in response to conditions

Molecular Function Assays:

  • Gene Expression Analysis:

    • Quantitative RT-PCR to measure expression of selected genes

    • RNA-seq for genome-wide expression profiling

    • Analysis of transcription factor binding using ChIP

  • Protein-Protein Interaction Assays:

    • Co-immunoprecipitation to identify physical interactors

    • Yeast two-hybrid screening

    • Proximity labeling approaches

  • Metabolic Analysis:

    • Metabolite profiling using mass spectrometry

    • Flux analysis using labeled precursors

    • Analysis of key metabolic pathways potentially impacted

High-Throughput Phenotypic Screening:

Systematic analysis of YDR526C mutants in large-scale phenotypic screens:

Phenotypic ApproachMethodologyPotential Insight
Synthetic Genetic Array (SGA)Cross YDR526C deletion with deletion collectionIdentify genetic interactions
Chemical-genetic profilingScreen YDR526C mutants against chemical librariesIdentify cellular pathways affected
High-content screeningAutomated microscopy with multiple cellular markersDetect subtle phenotypic changes
Barcode sequencingPool experiments with tagged mutantsQuantitative fitness defects

How can systems biology approaches integrate multiple data types to understand YDR526C function?

Systems biology provides powerful frameworks to integrate diverse data types for elucidating the function of uncharacterized proteins like YDR526C:

Multi-Omics Data Integration:

  • Genomics-Transcriptomics-Proteomics Integration:

    • Combine gene expression data with protein abundance measurements

    • Correlate YDR526C expression patterns with other genes/proteins

    • Identify discrepancies between transcript and protein levels that might indicate post-transcriptional regulation

  • Functional Genomics Data Integration:

    • Overlay genetic interaction data with physical interaction networks

    • Integrate ChIP-seq data to identify transcriptional regulatory relationships

    • Combine with metabolomics data to link YDR526C to metabolic pathways

  • Phenomics Integration:

    • Correlate high-throughput phenotypic profiles with molecular data

    • Identify conditions where YDR526C expression changes correlate with specific phenotypes

    • Connect cellular responses to molecular mechanisms

Network Biology Approaches:

  • Integrated Network Construction:

    • Build multi-layered networks incorporating:

      • Protein-protein interactions

      • Genetic interactions

      • Co-expression relationships

      • Metabolic connections

    • Position YDR526C within these networks to understand its context

  • Module Identification:

    • Apply clustering algorithms to identify functional modules

    • Determine if YDR526C belongs to specific modules

    • The superparamagnetic clustering algorithm with transcription factor information (SPCTF) can help identify modules with higher biological relevance

  • Network Perturbation Analysis:

    • Simulate the effects of YDR526C deletion/overexpression on network properties

    • Identify critical nodes and edges affected by YDR526C manipulation

Computational Modeling:

  • Constraint-Based Models:

    • Incorporate YDR526C into genome-scale metabolic models

    • Perform flux balance analysis to predict metabolic consequences

    • Identify potential metabolic roles based on model predictions

  • Dynamic Models:

    • Develop ordinary differential equation models for pathways involving YDR526C

    • Simulate temporal responses to perturbations

    • Test hypotheses about YDR526C function in silico

Data Visualization and Integration Tools:

Tool TypeExamplesApplication to YDR526C Research
CytoscapeNetwork visualization and analysisVisualize YDR526C in interaction networks
R/BioconductorStatistical analysis packagesIntegrate multi-omics datasets
PathVisioPathway visualizationMap YDR526C data onto biological pathways
MorpheusHeat map visualizationCompare multi-condition expression data
STRINGProtein interaction databaseIdentify high-confidence interaction partners

The integration of these diverse data types through systems biology approaches can reveal emergent properties and functional relationships that would not be apparent from any single data type. This holistic view can generate testable hypotheses about YDR526C function and guide targeted experimental validation.

What approaches can be used to study the involvement of YDR526C in potential stress response pathways?

Understanding the potential role of YDR526C in stress response pathways requires a multi-faceted approach combining physiological, genetic, and molecular techniques:

Stress Exposure Experiments:

  • Systematic Stress Screening:

    • Expose wild-type and YDR526C deletion strains to various stressors:

      • Oxidative stress (H₂O₂, menadione, paraquat)

      • Heat shock (37°C, 42°C)

      • Cold shock (4°C, 15°C)

      • Osmotic stress (NaCl, sorbitol)

      • DNA damage (UV, MMS, hydroxyurea)

      • ER stress (tunicamycin, DTT)

      • Nutrient limitation

    • Monitor growth parameters and survival rates quantitatively

    • Perform time-course analyses to capture dynamic responses

  • Dose-Response Relationships:

    • Determine EC₅₀ values for different stressors

    • Compare stress tolerance thresholds between wild-type and mutant strains

    • Establish whether YDR526C affects stress sensitivity or resistance

Molecular Response Analysis:

  • Transcriptional Response:

    • Perform RNA-Seq or microarray analysis under stress conditions

    • Compare transcriptional profiles between wild-type and YDR526C mutants

    • Identify stress-responsive genes affected by YDR526C deletion

    • Focus on known stress response pathways (ESR, HSR, UPR, etc.)

  • Protein Level Changes:

    • Monitor stress-induced protein expression changes using proteomics

    • Examine post-translational modifications under stress

    • Track protein localization changes during stress response

  • Stress-Activated Signaling Pathways:

    • Analyze activation of stress-responsive MAP kinases (Hog1, Slt2, etc.)

    • Examine transcription factor activation (Msn2/4, Hsf1, Yap1)

    • Determine if YDR526C affects signal transduction in these pathways

Genetic Interaction Studies:

  • Double Mutant Analysis:

    • Create double mutants with known stress response genes

    • Test for synthetic lethality, suppression, or enhancement

    • Focus on genes in specific stress pathways to narrow down function

  • Dosage Suppression Analysis:

    • Overexpress YDR526C in strains defective in stress response pathways

    • Test if YDR526C can compensate for these defects

    • Analyze genome-wide dosage suppressor networks to identify functional connections

  • Bypass Suppression:

    • Identify genes whose overexpression can bypass YDR526C deletion phenotypes

    • Map these genes to specific stress response pathways

Experimental Design Considerations:

Design ElementImplementationPurpose
Time-course samplingCollect samples at multiple time points after stressCapture dynamic response patterns
Dosage gradientsTest multiple concentrations of stressorsDetermine threshold effects
Combinatorial stressesApply multiple stresses simultaneouslyIdentify pathway-specific effects
Recovery experimentsRemove stress and monitor recoveryAssess adaptation vs. resistance
Single-cell analysesUse flow cytometry or microscopyDetect heterogeneous responses

Each experiment should include at least three independent biological replicates and appropriate controls to ensure statistical validity and reproducibility of findings .

How can I design experiments to investigate potential cell cycle roles of YDR526C?

Investigating the potential role of YDR526C in cell cycle regulation requires a comprehensive experimental strategy combining genetic, cytological, and molecular approaches:

Cell Cycle Progression Analysis:

  • Synchronization Experiments:

    • Synchronize wild-type and YDR526C deletion strains using:

      • α-factor arrest-release (G1 synchronization)

      • Hydroxyurea treatment (S-phase arrest)

      • Nocodazole treatment (G2/M arrest)

      • Temperature-shift of cdc mutants

    • Follow cell cycle progression by:

      • Flow cytometry for DNA content

      • Budding index determination

      • Expression of phase-specific markers

  • Cell Cycle Checkpoint Analysis:

    • Test checkpoint activation in response to DNA damage

    • Examine spindle assembly checkpoint function

    • Assess DNA replication checkpoint activation

    • Compare checkpoint recovery between wild-type and YDR526C mutants

Genetic Interactions with Cell Cycle Regulators:

  • Double Mutant Analysis:

    • Create double mutants with key cell cycle genes:

      • Cyclins (CLN1-3, CLB1-6)

      • Cyclin-dependent kinases (CDC28)

      • Cell cycle transcription factors (SWI4, SWI6, MBP1)

      • Checkpoint genes (RAD9, MAD2, MEC1)

    • Test for synthetic lethality, growth defects, or genetic suppression

  • Overexpression Studies:

    • Overexpress YDR526C and monitor cell cycle effects

    • Determine if YDR526C overexpression can suppress cell cycle mutants

    • Test if cell cycle regulators can suppress YDR526C mutant phenotypes

Molecular and Cellular Approaches:

  • YDR526C Expression During Cell Cycle:

    • Analyze YDR526C mRNA levels across cell cycle phases

    • Monitor YDR526C protein abundance and modifications

    • Determine if YDR526C is regulated by cell cycle transcription factors

  • Protein Localization During Cell Cycle:

    • Create functional fluorescent protein fusions with YDR526C

    • Track localization throughout cell cycle progression

    • Co-localize with known cell cycle structures (spindle, bud neck, kinetochores)

  • Chromosome Dynamics and Segregation:

    • Analyze chromosome segregation in YDR526C mutants

    • Examine spindle morphology and function

    • Assess chromosome cohesion and condensation

    • Measure chromosome loss rates

Computational Analysis:

  • Cell Cycle Gene Co-expression:

    • Apply superparamagnetic clustering algorithms with transcription factor information (SPCTF) to identify co-regulated genes

    • Analyze if YDR526C clusters with known cell cycle genes

    • Examine temporal expression patterns in synchrony experiments

  • Regulatory Motif Analysis:

    • Search for cell cycle-specific regulatory elements in YDR526C promoter

    • Determine if YDR526C is regulated by cell cycle transcription factors

    • Use the MUSA (motif finding using an unsupervised approach) algorithm to identify binding sites

Experimental Design Table:

ExperimentMethodologyExpected Outcome if Cell Cycle-RelatedControls
Synchronizationα-factor arrest-releasePhase-specific expression patternKnown cell cycle genes (CLN2, CLB2)
Cell cycle phenotypesMicroscopy of asynchronous culturesAbnormal cell morphology or accumulation in specific phasesWild-type strain
Checkpoint responseUV/MMS treatment followed by FACSAltered checkpoint activation or recoveryrad9Δ (checkpoint defective)
Co-expression analysisRNA-Seq of synchronized cellsCorrelation with known cell cycle genesRandom gene set comparison
ChIP analysisChIP for cell cycle TFs at YDR526C promoterBinding of MBF or SBF complexesACT1 (non-cell cycle)

By systematically implementing these approaches and carefully controlling experimental variables, researchers can determine whether YDR526C plays a role in cell cycle regulation and characterize the nature of that involvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.