Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL015C (YFL015C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
YFL015C; Uncharacterized protein YFL015C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YFL015C
Target Protein Sequence
MLAYTFPSFNFYVNGFFSFLFLFLFLFPSLLRFYVILCRPLQVATYPLNRCQQYSSLAIF TASGFWLLVLVPRAKGPSTRRHCYRQLAPTHHRPFFSIFGWAVSGIRPLPEIFTWICASP FFLHSLTPPTFSHFSVYQEEKKEKRRTPKNTEQEGNRMCIWMSG
Uniprot No.

Target Background

Database Links

STRING: 4932.YFL015C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and basic characteristics of YFL015C?

YFL015C is a putative uncharacterized protein located on chromosome VI of Saccharomyces cerevisiae at position 106463 . It is classified as a hypothetical protein in the Saccharomyces Genome Database, which is derived from the laboratory strain S288C . As part of the reference genome, this locus has been sequenced but has limited functional characterization. The SGD (Saccharomyces Genome Database) provides basic sequence-derived information including length, molecular weight, and isoelectric point, as well as any experimentally-determined data such as median abundance and median absolute deviation when available . Researchers can access the complete DNA or protein sequence through the SGD, which also offers genomic context and coordinates for detailed positional analysis.

How do I determine if YFL015C is a true protein-coding gene?

Determining whether YFL015C is a true protein-coding gene versus a non-coding sequence requires multiple computational and experimental approaches. The traditional methods of assessment included the Codon Bias Index (CBI) or the Codon Adaptation Index (CAI), but these have limitations, particularly for ORFs shorter than 150 codons with low CAI scores that nonetheless have identified phenotypes . More accurate assessment can be performed using the Z-curve-based algorithm, which provides better than 95% accuracy in identifying protein-coding genes in yeast . The YZ score derived from this algorithm can be calculated for YFL015C, where scores >0.5 suggest coding potential, while scores <0.5 suggest non-coding sequences . Experimentally, evidence of transcription (via RNA-seq) and translation (via proteomics) would provide stronger evidence of gene functionality. Additionally, researchers should examine conservation patterns across related yeast species, as functional genes tend to show evolutionary conservation.

What experimental approaches can verify the expression of YFL015C?

Verification of YFL015C expression requires a multi-faceted approach combining both transcriptional and translational evidence. Begin with RT-PCR or RNA-seq to detect transcription of the locus under various growth conditions, as expression may be condition-specific. For translational verification, tagged fusion proteins (HA, FLAG, or GFP) can be created through CRISPR-Cas9 mediated genome editing at the endogenous locus . The CRI-SPA method (CRISPR-Cas9 assisted strain construction) can be particularly useful for creating these tagged variants efficiently . Western blotting using antibodies against the tag can then confirm protein expression. Mass spectrometry-based proteomics provides another approach to detect the protein directly. Additionally, ribosome profiling can provide evidence of active translation at the locus. Integration of these methods provides robust verification of gene expression and can also offer insights into the regulation patterns of YFL015C under different experimental conditions.

How can I determine the function of the uncharacterized YFL015C protein?

Determining the function of YFL015C requires a systematic approach combining multiple experimental strategies. First, perform detailed bioinformatic analysis including protein domain prediction, secondary structure analysis, and comparison with characterized proteins across species. Next, implement genetic approaches such as gene deletion using CRISPR-Cas9 technology, followed by comprehensive phenotypic screening across diverse growth conditions, stressors, and carbon sources to identify condition-specific functions . Complementary approaches include synthetic genetic array (SGA) analysis to identify genetic interactions, which can reveal functional relationships with known pathways. The CRI-SPA method is particularly valuable for high-throughput strain construction needed for these genetic screens . Protein localization studies using fluorescent tags can provide insights into cellular compartmentalization, while affinity purification coupled with mass spectrometry can identify interaction partners. Metabolomic profiling of deletion mutants may reveal altered metabolic pathways. Integration of these diverse datasets using systems biology approaches can ultimately position YFL015C within the cellular network and provide functional insights even without direct homology to characterized proteins.

What mutation rates are observed in the chromosomal region containing YFL015C?

Studies examining mutation rates across yeast chromosomes have revealed significant variation, with up to 6-fold differences observed even across a single chromosome . Based on its position on chromosome VI (position 106463), YFL015C would experience mutation rates influenced by its specific chromosomal context . The mutation rate at this locus would be affected by several factors, including its proximity to origins of replication, as mutation rates correlate with replication timing . To precisely measure mutation rates at the YFL015C locus, researchers should implement reporter-based assays integrated at or near this position. The CAN1 forward mutation assay or URA3 reverse mutation systems could be adapted for this purpose. Additionally, long-term evolution experiments followed by whole-genome sequencing of multiple evolved lines can reveal natural mutation patterns at this locus. When analyzing mutation data, researchers should account for regional biases in mutation types and frequencies, which may influence adaptive potential of this gene region. Comparative analysis with mutation rates of neighboring genes (YFL019C and YFL012W) would provide contextual understanding of regional mutational processes .

How does YFL015C interact with other genes in genetic networks?

Mapping the genetic interaction network of YFL015C requires systematic approaches to identify both negative (synthetic sick/lethal) and positive (suppressive) interactions. The most comprehensive approach involves using the yeast deletion collection to perform synthetic genetic array (SGA) analysis with a YFL015C deletion strain as the query . The CRI-SPA method provides an efficient way to generate the necessary double mutant strains by combining CRISPR-Cas9 genome editing with yeast mating methodologies . This approach avoids the need for sporulation and can significantly accelerate the screening process. Quantitative assessment of colony size or growth rates in double mutants compared to single mutants reveals the strength and direction of genetic interactions. Additionally, targeted epistasis analysis with genes in specific pathways of interest can provide focused insights. For computational prediction of interactions, researchers should leverage existing genetic interaction databases and co-expression networks. The resulting interaction network can be visualized using network analysis tools, with clusters of interactions often suggesting functional relationships. Genetic interaction profiles can be compared to those of characterized genes to identify genes with similar functions through the principle of profile similarity.

What are the optimal protocols for gene deletion and modification of YFL015C?

For efficient deletion and modification of YFL015C, CRISPR-Cas9 based methods offer the highest precision and efficiency. The CRI-SPA method (CRISPR-Cas9 assisted strain construction) is particularly suitable, as it combines the simplicity of yeast mating for manipulation with the versatility of CRISPR-Cas9 technology . For gene deletion, design guide RNAs (gRNAs) targeting the 5' and 3' regions of YFL015C, along with a repair template containing a selectable marker flanked by 40-60bp homology arms matching the sequences adjacent to the cut sites. For precise modifications such as point mutations or tags, use a single gRNA with a repair template carrying the desired modification. The repair template should include silent mutations in the PAM site to prevent re-cutting after repair. For C-terminal tagging, the CRI-SPA method allows high-throughput processing, making it feasible to create multiple tagged variants simultaneously . When introducing modifications, consider potential effects on adjacent genes or regulatory elements, particularly important for YFL015C which is located at position 106463 on chromosome VI . Always verify modifications by PCR and sequencing to confirm successful editing and rule out off-target effects or unintended genomic rearrangements.

How can I analyze the expression patterns of YFL015C under different conditions?

Analyzing expression patterns of YFL015C requires a comprehensive approach combining transcriptional and translational analyses across diverse conditions. For transcriptional analysis, RT-qPCR offers a targeted, sensitive approach for specific conditions, while RNA-seq provides genome-wide context and captures alternative transcripts. Design primers specific to YFL015C, avoiding cross-reactivity with similar sequences, and use stable reference genes (ACT1, TDH3) for normalization. For translational analysis, Western blotting with tagged YFL015C (requiring genetic modification as described in section 4.1) or protein-specific antibodies can quantify protein levels. Additionally, ribosome profiling provides genome-wide translational status with nucleotide resolution. To comprehensively map condition-dependent expression, systematically test growth phases (log, diauxic shift, stationary), nutrient limitations (carbon, nitrogen, phosphate), stress conditions (oxidative, osmotic, temperature), and different carbon sources. Time-course sampling is essential to capture dynamic expression changes. For high-throughput screening, create a YFL015C-reporter fusion (e.g., with luciferase or fluorescent protein) to monitor expression in real-time across a condition library. Statistical analysis should account for biological replicates (minimum n=3) and appropriate controls, with validation of significant findings using orthogonal methods.

What bioinformatic approaches can predict the structure and function of YFL015C?

Predicting the structure and function of YFL015C requires an integrated bioinformatic pipeline combining sequence-based and structure-based approaches. Begin with sequence analysis using tools like PSI-BLAST and HHpred to identify remote homologs that might not be detected by standard BLAST searches. For domain prediction, use InterProScan to identify conserved functional domains, motifs, and signature patterns. Secondary structure elements can be predicted using PSIPRED or JPred, while transmembrane regions can be identified using TMHMM or Phobius. For tertiary structure prediction, AlphaFold2 has revolutionized accuracy for proteins without close homologs, providing reliable structural models that can suggest functional sites. I-TASSER and SWISS-MODEL offer alternative approaches for comparative modeling. Post-translational modification sites can be predicted using tools like NetPhos (phosphorylation) and NetNGlyc (glycosylation). Functional annotation can be enhanced through Gene Ontology term prediction using tools like PANNZER2 or DeepGOPlus. Protein-protein interaction networks can be predicted using STRING or STITCH. Integrate these predictions with experimental data available in SGD for YFL015C and similar hypothetical proteins. Finally, molecular dynamics simulations can provide insights into protein flexibility and potential ligand binding sites, generating testable hypotheses for experimental validation.

How do I analyze genetic interaction data for YFL015C from high-throughput screens?

Analyzing genetic interaction data for YFL015C from high-throughput screens requires a systematic approach to handle complex datasets while minimizing false positives. Begin with quality control by examining plate position effects, batch variations, and technical replicates to ensure data reliability. Calculate genetic interaction scores using established methods such as ε-scores (observed growth of double mutant minus expected growth based on multiplicative model) or SGA scores. Apply appropriate statistical thresholds (typically p<0.05 with multiple testing correction) to identify significant interactions. Hierarchical clustering of interaction profiles can reveal functional relationships, as genes in the same pathway often show similar interaction patterns. Compare the YFL015C interaction profile with profiles of known genes to identify functional similarities through profile correlation analysis. Enrichment analysis of interacting genes can identify overrepresented pathways or processes using tools like GO Term Finder. Network visualization using platforms such as Cytoscape helps interpret complex interaction networks. For validation, select strong interactions for targeted confirmation using independent methods such as growth curve analysis or competition assays. Finally, integrate interaction data with other datasets (expression correlations, protein-protein interactions) to strengthen functional hypotheses and position YFL015C within the cellular network context.

How can I determine if YFL015C is conserved across yeast species and other fungi?

Determining the evolutionary conservation of YFL015C requires a comprehensive comparative genomics approach. Start with a systematic BLASTP search of the YFL015C protein sequence against fungal genome databases, including closely related Saccharomyces species, other yeasts within Saccharomycetaceae, and more distant fungal lineages. For each potential homolog, calculate sequence identity and similarity percentages, and examine the coverage of alignments. Synteny analysis is crucial for distinguishing orthologs from paralogs—examine the conservation of gene order in the regions surrounding YFL015C across species using tools like SynFind or Genomicus. Multiple sequence alignment with MUSCLE or MAFFT allows visualization of conserved domains and residues, which often indicate functional importance. Calculate evolutionary rates (dN/dS ratios) to identify signatures of selective pressure, where ratios <1 suggest purifying selection and functional constraint. Phylogenetic analysis using maximum likelihood or Bayesian methods can establish the evolutionary history of the gene and identify potential duplication or loss events. For distantly related homologs, profile-based methods like PSI-BLAST or HMMER may detect relationships missed by pairwise alignments. Finally, examine the presence of conserved regulatory elements in promoter regions, as functional conservation often extends to transcriptional regulation. This comprehensive analysis will establish whether YFL015C represents a species-specific adaptation or a more broadly conserved fungal gene.

What statistical approaches are best for analyzing YFL015C expression and functional data?

Statistical analysis of YFL015C expression and functional data requires tailored approaches depending on the experimental design and data characteristics. For expression data from qPCR, use the ΔΔCt method with appropriate reference genes, applying ANOVA with post-hoc tests for multi-condition comparisons. For RNA-seq data, employ DESeq2 or edgeR for differential expression analysis, using false discovery rate (FDR) correction for multiple testing. When analyzing proteomics data, normalization for total protein abundance is essential before applying statistical tests. For growth phenotype data, growth curve parameters (lag phase, doubling time, maximum OD) should be extracted using tools like GrowthRates and compared using appropriate parametric or non-parametric tests depending on data distribution. For high-throughput functional screens, robust Z-scores can identify significant hits while controlling for plate-specific effects. When analyzing genetic interaction data, use established metrics like ε-scores or SGA scores with appropriate null models. For all analyses, perform power calculations to ensure sufficient replication (typically n≥3 biological replicates). Multivariate methods like principal component analysis or partial least squares regression are valuable for integrating multiple data types. When interpreting results, distinguish between statistical significance and biological significance by considering effect sizes alongside p-values. Visualization using appropriate plots (heatmaps for expression data, interaction networks for genetic data) facilitates interpretation of complex datasets. Document all statistical parameters and tests thoroughly for reproducibility.

How can high-throughput technologies advance our understanding of YFL015C function?

High-throughput technologies offer unprecedented opportunities to elucidate the function of uncharacterized proteins like YFL015C. The CRI-SPA method represents a significant advancement, combining CRISPR-Cas9 genome editing with yeast mating to enable high-throughput strain construction without requiring meiosis and sporulation . This approach can rapidly generate thousands of YFL015C variant strains for functional screening. To comprehensively characterize YFL015C, implement parallel approaches including: (1) Pooled CRISPR screens with thousands of gRNAs targeting different aspects of YFL015C to identify functional domains; (2) Barcode-based chemical genomics using the YFL015C deletion strain against thousands of compounds to identify condition-specific phenotypes; (3) Deep mutational scanning to systematically assess the impact of every possible amino acid substitution on protein function; (4) Single-cell RNA-seq to capture cell-to-cell variation in YFL015C expression and potential stochastic roles; and (5) Proximity labeling proteomics (BioID or APEX) to identify the dynamic interactome of YFL015C under different conditions. The integration of these datasets using machine learning approaches can identify patterns not apparent in single experiments. Additionally, the development of comprehensive CRISPR interference and activation libraries for yeasts will enable modulation of YFL015C expression without genetic modification, facilitating dosage-sensitive functional studies.

What are the implications of YFL015C location in relation to chromosome VI replication timing?

The positional context of YFL015C at location 106463 on chromosome VI has significant implications for its evolution, regulation, and potential function . Studies have demonstrated that mutation rates can vary up to 6-fold across a single chromosome, with this variation correlating with replication timing . This suggests that YFL015C's genomic location may subject it to specific mutational pressures based on when this region replicates during S-phase. Future research should investigate whether YFL015C falls within an early or late-replicating region using replication timing maps, as this could influence its evolutionary trajectory. Furthermore, chromatin structure at this locus should be characterized, as replication timing correlates with chromatin accessibility. Research should examine whether YFL015C expression is coordinated with replication timing, as co-regulation of genes within replication domains has been observed in other systems. The position of YFL015C relative to nearby origins of replication (ARS elements) should be mapped precisely, and potential associations with the nuclear periphery or specific chromosomal domains should be investigated using techniques like Hi-C or imaging. Understanding these contextual factors may provide insights into why this gene remains uncharacterized despite extensive studies of the yeast genome. Additionally, comparative genomics focused on this specific chromosomal region across related yeast species could reveal whether this positional context is conserved and potentially functionally relevant.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.