Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL032W (YFL032W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize fulfilling requests for specified tags. Please communicate any specific tag requirements.
Synonyms
YFL032W; Putative uncharacterized protein YFL032W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YFL032W
Target Protein Sequence
MRVVRQSGSALSRAKKSRKYTSYRVMNVVLNTLFSFVLAPYIHYILEEISPQWTTREMNT EICFLAKFSFLLVFLFYLNFQGFNSVSNITTSSSPTYDNNRHYGND
Uniprot No.

Target Background

Database Links

STRING: 4932.YFL032W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YFL032W and what is currently known about its genomic context?

YFL032W is a putative uncharacterized protein in Saccharomyces cerevisiae, with sequence information available in the Saccharomyces Genome Database (SGD). The reference genome sequence is derived from laboratory strain S288C . While specific functions remain under investigation, researchers can access basic sequence-derived information (length, molecular weight, isoelectric point) and experimentally-determined data (median abundance, median absolute deviation) through the SGD .

For initial characterization, researchers should:

  • Download DNA or protein sequences from SGD

  • Analyze genomic context and coordinates

  • Use available tools like BLASTN, BLASTP, and restriction fragment maps to identify potential homologs

  • Review GO Annotations that indicate molecular function, biological processes, and cellular components

What expression systems are most effective for recombinant production of YFL032W?

When expressing YFL032W recombinantly, researchers should consider several factors that influence successful expression based on experimental systems established for other yeast proteins:

  • Homologous expression in S. cerevisiae: This maintains native cellular machinery and post-translational modifications

  • Heterologous expression systems: These can be used if higher yields are required

For homologous expression, consider the following protocol parameters based on successful recombinant yeast expression systems:

ParameterOptimal RangeConsiderations
Temperature30-34°CHigher temperatures (34°C) impact cell viability
pH5.0-5.5 initialAdjust with NaOH solution for stability
Sugar concentration120-160 g/LLower concentrations (120 g/L) may improve protein expression
Oxidation-reduction potential (ORP)-50 to +50 mVLower ORP values (-50 mV) show higher productivity

What phenotypes are associated with YFL032W deletion or mutation?

The SGD database contains curated phenotype annotations for YFL032W that include:

  • Observable phenotypes

  • Qualifiers (e.g., "abnormal")

  • Mutant type information (e.g., null mutations)

  • Strain background effects

  • Classification as classical genetics or high-throughput studies

When studying phenotypes associated with YFL032W:

  • Review both manually curated and high-throughput GO Annotations in SGD

  • Examine computational annotations that may predict function

  • Compare phenotypes across different strain backgrounds to identify context-dependent effects

  • Consider that uncharacterized proteins may have subtle phenotypes that only manifest under specific environmental conditions

What methodological approaches can characterize the function of uncharacterized protein YFL032W?

A comprehensive approach to characterizing YFL032W should include:

Genomic approaches:

  • Generate knockout/knockdown strains using CRISPR-Cas9 or traditional homologous recombination

  • Create tagged versions (GFP, FLAG, etc.) to track localization and interactions

  • Perform genome-wide synthetic genetic array (SGA) analysis to identify genetic interactions

Proteomic approaches:

  • Immunoprecipitation coupled with mass spectrometry to identify interaction partners

  • Structural analysis using X-ray crystallography or cryo-EM

  • Post-translational modification profiling

Transcriptomic approaches:

  • RNA-seq analysis comparing wild-type and YFL032W mutant strains under various conditions

  • Ribosome profiling to assess translational impacts

Metabolomic approaches:

  • Metabolite profiling to identify biochemical pathways affected by YFL032W mutation

How can I design experiments to identify potential interaction partners of YFL032W?

To identify interaction partners, researchers should implement multiple complementary approaches:

  • Co-immunoprecipitation with mass spectrometry:

    • Express YFL032W with an affinity tag (like FLAG or HA)

    • Lyse cells under native conditions to preserve protein interactions

    • Immunoprecipitate using tag-specific antibodies

    • Analyze co-precipitated proteins by mass spectrometry

  • Yeast two-hybrid screening:

    • Clone YFL032W as bait construct

    • Screen against a yeast genomic library

    • Validate positive interactions with secondary assays

  • Proximity-based labeling:

    • Fuse YFL032W to enzymes like BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Genetic interaction screening:

    • Create YFL032W deletion strain

    • Cross with genome-wide deletion collection

    • Identify synthetic lethal or synthetic sick interactions

What are the recommended protocols for protein extraction and purification of YFL032W?

Based on methodologies successfully applied to yeast proteins, the following protocol is recommended:

Cell growth and harvesting:

  • Culture yeast cells expressing YFL032W at 30°C with appropriate selection

  • Harvest cells by centrifugation (13,261 × g, 20°C, 20 min) using appropriate rotors like JLA-9.1000

  • Wash cell pellet with sterile water

Cell lysis and protein extraction:

  • Resuspend cells in lysis buffer containing protease inhibitors

  • Lyse cells using glass beads or enzymatic methods

  • Clear lysate by centrifugation

Purification strategy:

  • For His-tagged proteins: Use Ni-NTA affinity chromatography

  • For native proteins: Use ion exchange followed by size exclusion chromatography

  • Consider detergent solubilization if YFL032W is membrane-associated

Quality control:

  • Assess purity by SDS-PAGE

  • Verify identity by Western blot or mass spectrometry

  • Evaluate structural integrity by circular dichroism

How do I address experimental challenges when working with recombinant S. cerevisiae expressing YFL032W?

Several methodological challenges may arise when working with recombinant S. cerevisiae:

Challenge: Cell flocculation

  • Solution: Implement acid treatment under controlled conditions (pH 2.5, 30°C) for 30 minutes followed by centrifugation

  • Monitor percentage of cell flocculation dispersion (PFD) to assess effectiveness

Challenge: Decreased cell viability

  • Solution: Implement a two-stage treatment process:

    • Acid treatment: pH 2.5-2.65, 30°C with air flow of 0.2 L/min

    • Reactivation: Supply carbon, phosphorus and nitrogen (0.01 g nitrogen per gram of cell) at 30°C with controlled ORP (-50 mV)

  • This approach maintains cell viability between 62-84% across multiple fermentation cycles

Challenge: Variable expression levels

  • Solution: Monitor key parameters:

    • Optimize temperature (30°C generally superior to 34°C)

    • Maintain lower ORP values (-50 mV) for higher productivity

    • Use substrate concentration of 120 g/L for optimal results

What computational approaches can help predict the function of YFL032W?

Computational prediction of YFL032W function should employ multiple complementary approaches:

  • Sequence-based methods:

    • BLASTP comparison against fungal genomes to identify homologs

    • Multiple sequence alignment to identify conserved domains

    • Motif searching for functional elements

    • Structural prediction using tools like AlphaFold

  • Network-based approaches:

    • Integrate existing protein-protein interaction data

    • Analyze co-expression patterns across multiple conditions

    • Examine genetic interaction networks

  • Ontology-based methods:

    • Analyze GO annotations and identify potential functions based on partial information

    • Use computational annotations in SGD to generate hypotheses

  • Literature mining:

    • Automated extraction of relationships from published research

    • Identification of proteins with similar characteristics

Each prediction should be experimentally validated using the methodological approaches described in previous sections.

How do I design controls for studies involving YFL032W manipulation?

Proper experimental controls are essential for reliable interpretation of YFL032W studies:

Genetic controls:

  • Wild-type strain (same genetic background as experimental strain)

  • Empty vector control for overexpression studies

  • Non-targeting guide RNA control for CRISPR experiments

  • Deletion/mutation of a characterized gene with known phenotype

Experimental controls:

  • Technical replicates (minimum triplicate) to assess experimental variation

  • Biological replicates from independent transformants

  • Positive controls for assay validation (e.g., use known flocculating strains when studying flocculation)

  • Time course sampling to capture dynamic responses

Validation approaches:

  • Complement YFL032W deletion with wild-type gene to confirm phenotype restoration

  • Use multiple methods to confirm protein-protein interactions

  • Implement appropriate statistical analysis (e.g., Student's t-test, as used in proliferation assays)

What strategies help resolve contradictory findings across different experimental conditions?

When faced with contradictory results when studying YFL032W:

  • Systematic variation of experimental parameters:

    • Test across temperature range (30-34°C)

    • Vary media composition

    • Examine effects of pH (2.5-5.0)

    • Assess impact of oxidation-reduction potential (-50 to +50 mV)

  • Strain background considerations:

    • Compare results across laboratory strains (S288C vs. other backgrounds)

    • Assess genetic differences that might influence phenotype

    • Consider genomic instability or suppressor mutations

  • Statistical approaches:

    • Implement more robust statistical methods

    • Remove outliers using validated methods like extreme Studentized deviate method

    • Increase sample size to improve statistical power

  • Methodology refinement:

    • Compare different extraction or purification methods

    • Implement more sensitive detection techniques

    • Validate reagents and antibodies thoroughly

How can YFL032W be engineered for specialized research applications?

While YFL032W remains uncharacterized, its potential modification for research applications could follow established approaches used with other yeast proteins:

Fusion strategies:

  • Create reporter fusions (GFP, luciferase) for localization and expression studies

  • Generate split protein complementation constructs for interaction studies

  • Develop proximity labeling fusions to identify nearby proteins in vivo

Regulatory engineering:

  • Place YFL032W under control of inducible promoters

  • Create expression variants with altered post-translational modification sites

  • Develop degradation-tagged versions for controlled protein depletion

Structural modifications:

  • Generate truncation libraries to identify functional domains

  • Create site-directed mutants at conserved residues

  • Design chimeric proteins with domains from related proteins

What techniques enable tracking of YFL032W expression and localization in living cells?

Researchers can monitor YFL032W dynamics using several advanced imaging and biochemical approaches:

Live-cell imaging techniques:

  • Fluorescent protein tagging at N- or C-terminus

  • Time-lapse microscopy under various environmental conditions

  • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

  • FLIM (Fluorescence Lifetime Imaging Microscopy) to detect protein interactions

Biochemical approaches for expression tracking:

  • Real-time quantitative PCR using primers specific for YFL032W

  • Use of comparative cycle threshold methods (like 2-∆∆ cycle threshold)

  • Protein quantification by Western blotting

  • Mass spectrometry-based absolute quantification

Subcellular fractionation:

  • Differential centrifugation to separate cellular compartments

  • Density gradient separation for refined compartment isolation

  • Sequential extraction methods for membrane-associated proteins

What are the optimal analytical methods for studying YFL032W interactions and modifications?

Based on techniques successfully applied to other yeast proteins, researchers should consider:

For protein interaction studies:

  • Affinity purification coupled with mass spectrometry

  • Surface plasmon resonance for binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

  • Microscale thermophoresis for weak interactions

For post-translational modification analysis:

  • Phosphoproteomic analysis using TiO₂ enrichment

  • Ubiquitination analysis using tagged ubiquitin pulldowns

  • Glycosylation analysis using lectin affinity purification

  • PTM-specific antibodies for Western blotting

For structural studies:

  • X-ray crystallography for high-resolution static structure

  • Cryo-electron microscopy for larger complexes

  • NMR spectroscopy for dynamic information

  • Hydrogen-deuterium exchange mass spectrometry for conformational data

How can I integrate multi-omics approaches to comprehensively characterize YFL032W function?

A systems biology approach integrating multiple data types can provide comprehensive understanding:

  • Data collection strategy:

    • Generate consistent datasets using the same strain backgrounds

    • Collect data under identical experimental conditions

    • Include appropriate time course sampling

  • Multi-omics integration framework:

Omics LayerTechniqueInformation Gained
GenomicsWhole genome sequencingGenetic background context
TranscriptomicsRNA-seqExpression patterns and regulation
ProteomicsMass spectrometryProtein abundance and modifications
MetabolomicsLC-MS/GC-MSMetabolic impact
InteractomicsAP-MS, Y2HProtein interaction network
PhenomicsHigh-content screeningFunctional outcomes
  • Computational integration:

    • Network analysis to identify functional modules

    • Causal inference to establish regulatory relationships

    • Machine learning for pattern recognition

    • Develop predictive models of YFL032W function

  • Validation experiments:

    • Test model predictions with targeted experiments

    • Refine models based on experimental outcomes

    • Iterate between computational and experimental approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.