Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFR012W (YFR012W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
DCV1; YFR012W; Protein DCV1; Demands CDC28 kinase activity for viability protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-202
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
DCV1
Target Protein Sequence
FSGFMICCLTSPIIRNWGLAQAAGVSYGTFGYCKTLNSFSCSRVRLIYNTSKEILPGPSL ERWWLSPKARHTIGGLLISIPVATCLTFISFALPLVIIFLFQTGGTNVSLITSNAILHIL TLLSTIFACTVILLLCMHRDPVTISSLYDLVWLANCSLFPLLVIGVHFLSFRFDTSAQSD RKHS
Uniprot No.

Target Background

Database Links

KEGG: sce:YFR012W

STRING: 4932.YFR012W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YFR012W and why is it significant for research?

YFR012W, also known as DCV1, is a putative uncharacterized protein in Saccharomyces cerevisiae that has gained significant research interest due to its potential role in cell cycle regulation and retrotransposon activity. The protein shows strong genetic interaction with cdc28-as1 mutant in the presence of 1-NM-PP1, suggesting its involvement in key cellular processes .

YFR012W is particularly significant because it represents one of the approximately 10% of open reading frames (ORFs) in S. cerevisiae that remain uncharacterized, despite the yeast being one of the most thoroughly studied model organisms . Understanding its function could provide insights into fundamental cellular mechanisms and potentially reveal new therapeutic targets.

What is currently known about the structural characteristics of YFR012W?

Bioinformatic analysis using the Transmembrane Helices Hidden Markov Models predicts that YFR012W likely contains four membrane domains with outward-facing polarity for both N and C-termini (or facing into a vesicle) . This structural organization differs from its paralog YOL019W, which also has four predicted membrane domains but with inward-facing polarity for both termini.

YFR012W is part of the SUR7 protein domain family, members of which typically localize to the plasma membrane . The transmembrane nature of YFR012W suggests it may function in membrane-associated processes, potentially in signaling or transport mechanisms.

Table 1: Predicted Structural Features of YFR012W and its Paralog

FeatureYFR012W (DCV1)YOL019W
Predicted membrane domains44
N and C-termini polarityOutward-facingInward-facing
Protein familySUR7 domain familySUR7 domain family
Confirmed localizationUnder investigationCell periphery, plasma membrane, vacuole

How does YFR012W relate to other proteins in the SUR7 domain family?

YFR012W belongs to the SUR7 protein domain family, which includes several other membrane proteins with diverse functions. Other members of this family include:

  • ECM7: A putative integral membrane protein with a role in calcium uptake

  • SUR7: A plasma membrane protein required for proper plasma membrane organization

  • FAT3: A protein required for fatty acid uptake

  • YNL194C: A plasma membrane protein required for sporulation and plasma membrane sphingolipid content

These family members share structural similarities with YFR012W but have distinct functions, primarily related to membrane organization, lipid metabolism, and ion transport. Research suggests that YFR012W may have functional overlap with these proteins, particularly in relation to membrane integrity and organization.

What are the most effective methods for generating YFR012W deletion mutants in S. cerevisiae?

The most effective approach for generating YFR012W deletion mutants involves homologous recombination of a PCR product containing a selectable marker (such as kanMX) flanked by YFR012W upstream and downstream sequences. The methodology typically includes:

  • PCR amplification: Generate a deletion cassette containing the kanMX gene flanked by 40-60 bp of sequence homologous to the regions immediately upstream and downstream of the YFR012W open reading frame.

  • Transformation: Transform the PCR product into S. cerevisiae using the lithium acetate/single-stranded carrier DNA/polyethylene glycol method.

  • Selection: Plate transformed cells on medium containing G418 (geneticin) to select for successful integrants.

  • Confirmation: Verify the deletion through PCR using primers that anneal to the upstream region of YFR012W and within the kanMX gene. Successful deletion should yield a band of approximately 1.5 Kbp .

This technique has been successfully employed to create YFR012W deletion strains in various genetic backgrounds, allowing for subsequent phenotypic analysis.

How can researchers effectively analyze the phenotype of YFR012W deletion mutants?

Phenotypic analysis of YFR012W deletion mutants should incorporate multiple complementary approaches:

  • Growth assays: Compare growth rates of wild-type and deletion strains under various conditions (different carbon sources, stress conditions, etc.). For YFR012W, particular attention should be paid to growth on xylose-containing media due to potential roles in carbon metabolism .

  • Microscopy with calcofluor white staining: This technique is particularly useful for observing bud growth direction and bud neck position, which have been reported to differ significantly in yfr012w deletion mutants compared to wild-type yeasts .

  • Fluorescence microscopy: GFP-tagged YFR012W can be used to determine protein localization. Current evidence suggests it may localize to the plasma membrane, similar to other SUR7 family proteins .

  • Ty3 transposition assay: Given that YFR012W deletion affects Ty3 retrotransposon activity, researchers should assess transposition efficiency using a galactose-inducible Ty3 element containing a selectable marker (e.g., HIS3) .

  • Genetic interaction screens: Test for synthetic interactions with genes involved in cell cycle regulation, particularly with cdc28-as1 in the presence of 1-NM-PP1, which has shown strong genetic interactions with YFR012W .

What are the recommended approaches for studying the functional relationship between YFR012W and its paralog YOL019W?

To investigate the functional relationship between YFR012W and YOL019W, researchers should consider:

  • Generate single and double deletions: Create yfr012w∆, yol019w∆, and yfr012w∆ yol019w∆ strains. While both genes are viable when deleted individually, the viability of the double deletion remains to be investigated .

  • Mating and tetrad dissection: Mate haploid yfr012w∆ and yol019w∆ strains, induce sporulation, and perform tetrad dissection, looking for spores carrying both deletion markers. Viability analysis of these spores will indicate whether the genes have redundant essential functions .

  • Comparative phenotypic analysis: Compare the phenotypes of single and double mutants under various conditions to identify shared and distinct functions.

  • Protein localization studies: Use fluorescently tagged versions of each protein to determine whether they colocalize or occupy distinct cellular compartments.

  • Complementation experiments: Test whether expression of one gene can rescue phenotypic defects associated with deletion of the other, which would suggest functional redundancy.

These approaches will help elucidate whether YFR012W and YOL019W have overlapping, complementary, or distinct cellular functions.

How does deletion of YFR012W impact Ty3 retrotransposon activity in S. cerevisiae?

Deletion of YFR012W significantly decreases the activity of the yeast retrotransposon Ty3. This has been demonstrated through transposition assays utilizing a galactose-inducible Ty3 element containing a histidine selectable marker .

In these experiments, wild-type and YFR012W deletion strains were transformed with a URA3 selectable plasmid containing a galactose-inducible Ty3 element. The Ty3 element contains a HIS3 marker gene with an artificial intron. Successful splicing, reverse transcription, and integration of the Ty3 mRNA results in HIS+ prototrophs. When patched to medium lacking histidine, the wild-type strain shows more papillae (indicating transposition events) than the YFR012W deletion mutant .

This reduction in Ty3 activity suggests that YFR012W may play a role in regulating retrotransposon mobility, potentially through effects on transcription, RNA processing, or chromatin structure. Understanding this interaction may provide insights into host-transposon interactions and genome stability mechanisms.

What is the evidence for YFR012W's involvement in cell cycle regulation?

Evidence for YFR012W's involvement in cell cycle regulation comes primarily from genetic interaction studies showing strong interaction with cdc28-as1 mutant in the presence of 1-NM-PP1 . CDC28 encodes the main cyclin-dependent kinase in S. cerevisiae, which is a key regulator of the cell cycle .

Additionally, bioinformatic analysis suggests that YFR012W deletion mutants show significant differences in bud growth direction and bud neck position in both bud size and nucleus location compared to wild-type yeasts . These phenotypes are closely related to cell cycle progression and cell division processes.

The potential role of YFR012W in cell cycle regulation could explain its genetic interaction with CDC28 and suggests it may be part of signaling pathways controlling cell division, morphogenesis, or cell polarity establishment during the cell cycle.

How does YFR012W relate to xylose metabolism in recombinant S. cerevisiae strains?

While YFR012W itself has not been directly implicated in xylose metabolism, several studies have investigated the roles of chromatin remodeling and histone modification factors in xylose utilization, which may have relevance to YFR012W function.

According to research on recombinant S. cerevisiae strains engineered for xylose metabolism, deletion of genes encoding components of chromatin remodeling complexes, including SWI3, RSC1, SPT10, UME6, or NGG1, increased static ethanol fermentation . Given that YFR012W may play a role in chromatin structure or gene regulation, it could potentially influence xylose metabolism through similar mechanisms.

Additionally, in the recombinant xylose-utilizing strain YRH396h, deletion of NGG1 (which encodes a component of the SAGA histone acetyltransferase complex) facilitated higher xylose consumption and increased ethanol production . This suggests that chromatin-associated proteins can significantly impact carbon source utilization, providing a potential parallel for investigating YFR012W's role in metabolism.

What are the current hypotheses regarding YFR012W's molecular function based on its predicted structure and genetic interactions?

Current hypotheses about YFR012W's molecular function include:

  • Membrane organization regulator: Based on its predicted transmembrane structure and membership in the SUR7 protein family, YFR012W may function in organizing specific domains within the plasma membrane, potentially affecting lipid distribution or protein localization .

  • Cell cycle checkpoint component: The strong genetic interaction with cdc28-as1 suggests YFR012W might participate in cell cycle checkpoints, possibly as a sensor or regulator of cell cycle progression signals .

  • Chromatin regulation factor: Given the effects of other chromatin-associated proteins on similar processes (retrotransposition, carbon metabolism), YFR012W might influence gene expression through effects on chromatin structure or histone modifications .

  • Retroelement regulator: The impact on Ty3 activity suggests YFR012W could function in host defense mechanisms against transposable elements or in regulating endogenous retroelement mobility .

  • Stress response mediator: Similar to other plasma membrane proteins, YFR012W might sense environmental changes and transmit signals to appropriate response pathways.

These hypotheses provide a framework for designing targeted experiments to elucidate YFR012W's precise molecular function.

What systems biology approaches would be most effective for elucidating the global regulatory network involving YFR012W?

To comprehensively map the global regulatory network involving YFR012W, several complementary systems biology approaches should be employed:

  • Transcriptomic analysis: Compare RNA-seq profiles between wild-type and yfr012w∆ strains under various conditions to identify differentially expressed genes. This approach was successfully used to study NGG1's role in xylose metabolism, revealing changes in central carbon metabolism and amino acid biosynthesis pathways .

  • Proteomics: Use mass spectrometry-based proteomics to identify changes in protein abundance and post-translational modifications in yfr012w∆ strains.

  • Synthetic genetic array (SGA) analysis: Systematically create double mutants with yfr012w∆ and analyze genetic interactions, which could reveal functional relationships with known cellular pathways.

  • Chromatin immunoprecipitation sequencing (ChIP-seq): If YFR012W is involved in chromatin regulation, ChIP-seq could identify genomic binding sites or affected chromatin regions.

  • Metabolomics: Analyze changes in metabolite profiles in yfr012w∆ strains, particularly focusing on membrane lipids and carbon metabolism intermediates.

  • Protein-protein interaction studies: Use techniques like affinity purification-mass spectrometry (AP-MS) or yeast two-hybrid screening to identify YFR012W's protein interaction partners.

  • Network analysis: Integrate these multiple data types to construct a comprehensive regulatory network, identifying key nodes and potential feedback mechanisms.

This multi-omics approach would provide a holistic view of YFR012W's role in cellular regulation and help prioritize specific pathways for in-depth functional analysis.

How might the function of YFR012W differ in laboratory strains versus natural isolates of S. cerevisiae?

The function of YFR012W might differ substantially between laboratory strains and natural isolates of S. cerevisiae due to several factors:

  • Genetic background effects: Laboratory strains often contain specific mutations that facilitate research but may alter cellular physiology. For example, many lab strains carry mutations in genes like HAP1, MIP1, or ADE2, which could influence YFR012W's function through genetic interactions .

  • Adaptive evolution: Natural isolates have evolved under diverse environmental pressures, potentially leading to functional adaptations in YFR012W. For instance, the natural yeast isolate S. cerevisiae YB-2625 shows superior xylose consumption efficiency compared to the model strain S. cerevisiae S288c , possibly due to differences in global regulators.

  • Allelic variation: Natural isolates might contain non-synonymous mutations in YFR012W that alter its function. Similar to how NGG1 in strain YB-2625 contains four non-synonymous mutations compared to S288c (Gly349Asp, Thr449Ser, Asn467Ser, and Ala477Thr) , YFR012W may have strain-specific variants.

  • Differential expression: Expression levels of YFR012W might vary between strains, affecting its physiological impact. Comparative transcriptomic analysis between different strains could reveal such differences.

To investigate these potential differences, researchers should conduct comparative functional studies of YFR012W across multiple S. cerevisiae strains, including both laboratory workhorses and diverse natural isolates from different environmental niches.

How does YFR012W potentially interact with chromatin remodeling complexes in S. cerevisiae?

While direct evidence for YFR012W interactions with chromatin remodeling complexes is limited, several parallels suggest potential functional connections:

  • Similarity to known chromatin regulators: The effects of YFR012W deletion on Ty3 retrotransposition mirror those observed with mutations in chromatin-associated factors. For example, components of the SAGA complex influence transposon mobility by affecting histone modifications and chromatin accessibility .

  • Impact on gene expression: If YFR012W influences chromatin structure or histone modifications, it could affect gene expression patterns similar to those observed in mutations of chromatin remodeling components like NGG1, SWI3, or SPT10 .

  • Potential parallel with NGG1: Deletion of NGG1, which encodes a component of the SAGA histone acetyltransferase complex, affects global acetylation states and significantly alters transcription of numerous genes in S. cerevisiae . YFR012W might function through similar mechanisms.

  • Cell cycle connection: Chromatin remodeling complexes are crucial for cell cycle-regulated gene expression, which aligns with YFR012W's genetic interaction with cdc28-as1 .

To investigate these potential interactions, researchers could perform co-immunoprecipitation experiments with YFR012W and known chromatin remodeling components, analyze histone modification patterns in yfr012w∆ strains, or conduct genetic interaction studies with mutations in chromatin remodeling complexes.

What methodologies should be used to investigate YFR012W's potential role in nitrogen metabolism?

Based on parallels with other regulatory systems, YFR012W might influence nitrogen metabolism. To investigate this potential role, researchers should employ:

  • Growth assays with different nitrogen sources: Compare growth rates of wild-type and yfr012w∆ strains on media containing preferred (e.g., ammonium, glutamine, asparagine) versus non-preferred (e.g., proline, urea) nitrogen sources. Similar experiments with NGG1 deletion strains revealed significant effects on nitrogen utilization .

  • Transcriptomic analysis focusing on nitrogen catabolite repression (NCR) genes: Analyze expression of nitrogen-regulated genes in yfr012w∆ strains, particularly focusing on:

    • Amino acid transporters (e.g., GAP1, AGP1, GNP1)

    • Nitrogen utilization enzymes (e.g., GLN1, GDH1, GDH2)

    • NCR transcription factors (e.g., GLN3, GAT1, DAL80)

  • Nitrogen uptake assays: Measure rates of nitrogen compound uptake using radiolabeled substrates or colorimetric assays.

  • Analysis of amino acid pools: Use HPLC or mass spectrometry to quantify intracellular amino acid concentrations in wild-type versus yfr012w∆ strains.

  • Reporter gene assays: Construct reporter systems using promoters of nitrogen-regulated genes to monitor their activity in wild-type versus yfr012w∆ backgrounds.

Table 2: Key Nitrogen Metabolism Genes to Monitor in YFR012W Studies

Gene CategoryRepresentative GenesFunction
TransportersGAP1, AGP1, GNP1, CAN1, PUT4Uptake of amino acids and other nitrogen compounds
Metabolic enzymesGLN1, GDH1, GDH2, ASN1, ARG1Nitrogen compound metabolism
Transcription factorsGLN3, GAT1, DAL80, GZF3, URE2Regulation of nitrogen catabolite repression
Signaling componentsTOR1, NPR1, SIT4, URE2Nitrogen-responsive signaling pathways

How might YFR012W contribute to membrane organization and its relationship to cell cycle progression?

The predicted transmembrane structure of YFR012W and its genetic interaction with cdc28-as1 suggest it may link membrane organization to cell cycle progression. Researchers should investigate this connection through:

  • Lipid raft analysis: Detergent-resistant membrane fractionation to determine if YFR012W localizes to lipid rafts and whether yfr012w∆ affects lipid raft composition. Other SUR7 family proteins localize to membrane compartments containing specific lipids and proteins .

  • Membrane fluidity measurements: Use fluorescence anisotropy or electron paramagnetic resonance to assess membrane fluidity changes in yfr012w∆ strains.

  • Cell cycle synchronization experiments: Synchronize yeast cultures and analyze YFR012W localization and membrane organization throughout the cell cycle using time-lapse microscopy.

  • Protein-protein interaction studies: Identify membrane proteins that interact with YFR012W, particularly those involved in cell cycle regulation or bud site selection.

  • Analysis of cell polarization markers: Examine the localization of polarity markers (e.g., Cdc42, Bem1) in wild-type versus yfr012w∆ strains during cell division.

  • Electron microscopy: Analyze membrane ultrastructure in yfr012w∆ strains, focusing on bud neck regions and sites of polarized growth.

The abnormal bud growth direction and bud neck position observed in yfr012w∆ strains strongly suggest YFR012W may function at the intersection of membrane organization and cell cycle control, potentially as a scaffold for localization of cell cycle regulators or as a sensor of membrane status that feeds into cell cycle checkpoints .

What emerging technologies could advance our understanding of YFR012W function?

Several cutting-edge technologies could significantly advance our understanding of YFR012W:

  • CRISPR-based screening: Genome-wide CRISPR screens in YFR012W mutant backgrounds could identify synthetic lethal or enhancer interactions, revealing functional pathways.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 could identify proteins that interact with or localize near YFR012W in vivo, providing insights into its functional context.

  • Single-cell RNA sequencing: This could reveal cell-to-cell variability in responses to YFR012W deletion, potentially uncovering subpopulation-specific effects.

  • Cryo-electron microscopy: For structural determination of YFR012W and its protein complexes, potentially revealing mechanistic insights.

  • AlphaFold2 and structural prediction: Using AI-based structural prediction to model YFR012W's structure and potential interactions, as has been done for numerous uncharacterized proteins .

  • Metabolic flux analysis: 13C-labeling experiments could track how YFR012W affects carbon and nitrogen metabolism dynamics.

  • Super-resolution microscopy: Techniques like STORM or PALM could provide nanometer-resolution images of YFR012W localization relative to other cellular structures.

  • Protein engineering approaches: Creating chimeric proteins between YFR012W and its paralog YOL019W could help identify functional domains.

These advanced approaches could overcome the limitations of traditional techniques and provide new insights into the molecular function of this uncharacterized protein.

What are the implications of YFR012W research for understanding human disease mechanisms?

Although YFR012W is a yeast protein, research on this uncharacterized protein has broader implications for human disease understanding:

  • Conserved cellular processes: Many fundamental cellular processes are conserved from yeast to humans. If YFR012W functions in universal processes like cell cycle regulation or membrane organization, findings may translate to human cellular mechanisms.

  • Model for uncharacterized human proteins: Approximately 20% of human genes encode proteins of unknown function . Methodologies developed to study YFR012W could serve as templates for investigating these uncharacterized human proteins.

  • Transposon regulation insights: YFR012W's role in regulating Ty3 activity may provide insights into human retrotransposon regulation. Aberrant human retrotransposon activity has been implicated in cancer, neurodegenerative diseases, and aging .

  • Membrane protein diseases: If YFR012W functions in membrane organization, research could inform understanding of human diseases caused by membrane protein dysfunction, including many channelopathies and lipid storage disorders.

  • Cell cycle dysregulation in cancer: Given YFR012W's potential role in cell cycle regulation, research might yield insights applicable to cancer biology, where cell cycle checkpoints are frequently disrupted.

By elucidating fundamental cellular mechanisms using the tractable yeast model system, YFR012W research could ultimately contribute to understanding analogous processes relevant to human disease.

How can computational approaches improve functional prediction for YFR012W and similar uncharacterized proteins?

Modern computational approaches offer powerful tools for predicting functions of uncharacterized proteins like YFR012W:

  • Advanced homology detection: Methods like HHPred that detect remote homology relationships could identify distant functional relatives of YFR012W beyond what standard BLAST searches reveal .

  • Structural prediction and comparison: AlphaFold2 and similar AI tools can predict protein structures with high accuracy. Structure-based comparisons using tools like Foldseek can then identify proteins with similar folds but low sequence similarity, suggesting potential functions .

  • Protein-protein interaction network analysis: Graph-based computational methods can predict functional associations based on the principle that proteins in similar network positions often share functions.

  • Integrative multi-omics approaches: Machine learning models that integrate diverse data types (genomic, transcriptomic, proteomic, metabolomic) can predict protein function based on patterns across these datasets.

  • Evolutionary analysis: Methods analyzing patterns of evolutionary conservation, co-evolution, and selection pressure can provide insights into functional constraints and important residues.

  • Text mining of scientific literature: Natural language processing techniques can extract functional relationships from published literature, even when not explicitly annotated in databases.

  • Sequence embedding models: Protein language models like ProtBERT or ESM-1b learn meaningful representations of protein sequences that can be leveraged for function prediction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.