Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFR056C (YFR056C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YFR056C; Putative uncharacterized protein YFR056C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YFR056C
Target Protein Sequence
MMVDPLYKGGLTKPLCSSGLRPITDSCVVIPNFDNSVRSIIVVNILVFAGILYSQFRNTL SIFSLWCPNTRAVFLFICPCLLYFYQGIFSTDEQIGTFNIIWMLRRLTIELIIRNLNAEK ER
Uniprot No.

Target Background

Database Links

STRING: 4932.YFR056C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YFR056C and where is it located in the S. cerevisiae genome?

YFR056C is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast). It is located on chromosome VI near the right telomeric region, approximately 5-7.5 kb from the telomere . The gene is part of a subtelomeric region that can be subject to silencing mechanisms, which has implications for its expression patterns and regulation. As with other yeast genes, the systematic name (YFR056C) indicates its chromosomal location, with "Y" designating yeast, "FR" indicating chromosome VI right arm, "056" denoting the relative position on the chromosome, and "C" signifying that it is transcribed from the complementary DNA strand.

How is YFR056C expression regulated in wild-type yeast cells?

YFR056C expression appears to be influenced by its subtelomeric location and chromatin structure. Studies have shown that YFR056C can be down-regulated over 2.5-fold in certain conditions . The gene's expression is partially regulated by Sir proteins, particularly Sir3, which are involved in heterochromatin formation and gene silencing. Chromatin immunoprecipitation (ChIP) analyses of RNA polymerase II (RNAPII) occupancy at YFR056C have indicated that repression of its transcription is only partially SIR3-dependent . This suggests multiple layers of regulation, including both Sir-dependent heterochromatin formation and potentially other transcriptional regulatory mechanisms.

What experimental approaches are recommended for initial characterization of YFR056C?

For initial characterization of an uncharacterized protein like YFR056C, a multi-faceted approach is recommended:

  • Gene expression analysis: qRT-PCR to quantify expression under various growth conditions and genetic backgrounds.

  • Protein localization: Construction of GFP-fusion proteins to determine subcellular localization, similar to approaches used for other yeast proteins like Yll056cp .

  • Phenotypic analysis of deletion mutants: Creating yFR056C deletion strains and analyzing their growth under various stress conditions.

  • Protein purification and biochemical characterization: Expression of recombinant YFR056C with affinity tags for purification and subsequent biochemical assays.

  • Protein-protein interaction studies: Yeast two-hybrid screening or affinity purification coupled with mass spectrometry.

When designing these experiments, it's crucial to consider the influence of the gene's subtelomeric location on its expression when interpreting results, as telomere-proximal genes can exhibit position effects.

How can I effectively express recombinant YFR056C for functional studies?

For optimal expression of recombinant YFR056C, consider the following methodological approach:

  • Expression system selection: While E. coli is commonly used, expressing in S. cerevisiae itself can be advantageous for proper folding and post-translational modifications. Use a strain with the endogenous YFR056C deleted to avoid interference.

  • Vector design considerations:

    • Include affinity tags (His6, GST, or FLAG) for purification

    • Consider inducible promoters like GAL1 to control expression timing

    • Include appropriate secretion signals if extracellular studies are needed

  • Optimization protocol:

    ParameterRecommended ApproachConsiderations
    TemperatureTest 25°C, 30°C, and 37°CLower temperatures may increase proper folding
    Induction time4-24 hours depending on stabilityMonitor by western blot
    Media compositionYPD vs. minimal media with supplementsNutrient availability affects expression levels
    Cell lysisGlass bead disruption or enzymatic methodsPreserve protein structure and activity
  • Purification strategy: Implement a two-step purification process using affinity chromatography followed by size-exclusion chromatography to obtain high purity protein.

  • Activity verification: Develop functional assays based on predicted protein functions from bioinformatic analyses and homology modeling.

Similar approaches have been successful for characterizing other previously uncharacterized yeast proteins such as the atypical short-chain dehydrogenase/reductase YLL056C .

What strategies can I use to investigate the function of YFR056C in relation to telomeric silencing?

To investigate YFR056C's potential role in telomeric silencing and chromosome boundary formation:

  • Genetic interaction analysis:

    • Create double mutants with known silencing factors (sir2Δ, sir3Δ, sir4Δ, rpd3Δ, sas2Δ)

    • Analyze synthetic genetic interactions similar to those observed between SAS-I complex and RPD3

    • Monitor for genetic interactions that show synthetic lethality or rescue phenotypes

  • Chromatin state analysis:

    • Perform ChIP-seq for histone modifications (H3K9ac, H4K16ac) around the YFR056C locus

    • Map heterochromatin boundary elements using Sir protein spreading assays

    • Implement reporter gene silencing assays with constructs inserted at varied distances from telomeres

  • Telomeric boundary element testing:

    • Use boundary element assays similar to those designed for testing Rpd3 function

    • Insert URA3 reporter genes at varying distances from telomeres in wild-type and YFR056C mutant strains

    • Assess repression using 5-FOA resistance and growth on uracil-deficient media

  • Transcriptome analysis:

    • Compare RNA-seq data from wild-type and YFR056C mutant strains

    • Focus analysis on subtelomeric genes to identify pattern changes

    • Quantify expression changes in genes like YFR055W that are neighboring YFR056C

This approach will help determine whether YFR056C plays a structural role in chromatin organization or has a more direct function in telomeric silencing mechanisms.

How can I differentiate between direct and indirect effects when studying YFR056C's influence on neighboring genes?

Differentiating between direct and indirect effects of YFR056C on neighboring gene expression requires controlled experimental approaches:

  • Temporal analysis of gene expression changes:

    • Implement an inducible/repressible YFR056C system using promoters like tetO or GAL1

    • Collect time-course data after YFR056C induction/repression

    • Primary (direct) effects typically occur rapidly, while secondary effects emerge later

  • Protein-DNA interaction mapping:

    • Perform ChIP-seq with tagged YFR056C to identify direct binding sites

    • Compare binding profiles with expression changes in neighboring genes

    • Implement DNA footprinting assays to confirm specific DNA interactions

  • Structure-function analysis:

    • Create point mutations in predicted functional domains of YFR056C

    • Assess the impact on both direct binding targets and downstream genes

    • Design domain swap experiments with similar proteins to identify functional regions

  • Reconstitution experiments:

    • For suspected enzymatic activities, perform in vitro reconstitution with purified components

    • Similar to approaches used for characterizing the aldehyde reductase activity of Yll056cp

    • Test substrate specificity and kinetic parameters

  • Controlled reference experiment design:

    Experiment TypeControl DesignData Interpretation
    Gene deletionInclude non-affected gene deletionsCompare specificity of effects
    ChIP experimentsInclude non-specific antibody controlsEstablish binding specificity
    Expression analysisAnalyze non-neighboring genesDistinguish positional from functional effects
    Genetic interactionsTest interactions with unrelated pathwaysIdentify pathway-specific effects

This systematic approach helps establish causality in complex genetic networks and distinguishes YFR056C's direct functions from secondary effects due to its genomic location.

How should I interpret contradictory results between genetic and biochemical analyses of YFR056C?

When faced with contradictory results between genetic and biochemical approaches studying YFR056C:

Remember that seemingly contradictory results often lead to new biological insights about complex regulatory mechanisms.

What bioinformatic approaches can help predict the function of YFR056C?

To predict the function of the uncharacterized protein YFR056C using bioinformatics:

  • Sequence-based analysis:

    • Perform sensitive homology searches using PSI-BLAST, HHpred, and HMMER against diverse databases

    • Identify conserved domains using InterPro, Pfam, and CDD

    • Analyze protein disorder regions with DISOPRED and MobiDB

  • Structural prediction and analysis:

    • Generate 3D structure predictions using AlphaFold2 or RoseTTAFold

    • Identify potential binding pockets and catalytic sites

    • Perform molecular docking studies with predicted ligands

    • Compare predicted structures with known proteins to identify functional homologs

  • Genomic context analysis:

    Analysis TypeTools/ResourcesInterpretation Focus
    Synteny analysisSyntTax, GenomicusConservation of gene neighborhood
    Co-expression networksSPELL, YeastNetFunctional associations
    Genetic interaction mapsTheCellMap.orgPathway membership
    Phylogenetic profilingPhyloProCo-evolution patterns
  • Integration with experimental data:

    • Correlate expression patterns with published datasets using tools like Expression Atlas

    • Match subcellular localization predictions with the Yeast GFP Fusion Localization Database

    • Compare with data from systematic functional genomics projects like the Saccharomyces Genome Deletion Project

  • Machine learning approaches:

    • Apply function prediction algorithms like FFPred, SIFTER, and DeepGOPlus

    • Use protein language models like ESM and ProtT5 to identify functional features

    • Validate predictions with available experimental data

When interpreting predictions for YFR056C, consider its subtelomeric location, as proteins in these regions often have roles in stress response, nutrient metabolism, or adaptation to environmental conditions .

How can I design a CRISPR-Cas9 system to study YFR056C function in S. cerevisiae?

For effective CRISPR-Cas9 manipulation of YFR056C in S. cerevisiae:

  • System design considerations:

    • Select appropriate Cas9 expression vectors (constitutive vs. inducible)

    • Choose RNA polymerase III promoters (SNR52, RPR1) for guide RNA expression

    • Design specific sgRNAs with minimal off-target effects

  • sgRNA design for YFR056C:

    ApplicationsgRNA Target RegionConsiderations
    Gene knockoutEarly coding sequencePAM sites with highest specificity
    N-terminal taggingNear start codonPreserve protein function
    C-terminal taggingNear stop codonAvoid disrupting regulatory elements
    Point mutationsSpecific codonsDesign appropriate repair templates
    Promoter modulationUpstream regulatory regionMap regulatory elements first
  • Repair template design:

    • Include 40-60 bp homology arms flanking the cut site

    • For tagging, ensure in-frame fusion with appropriate linkers

    • Consider using selectable markers (URA3, KanMX) with loxP sites for marker recycling

    • Implement silent mutations in the PAM site or sgRNA target region to prevent re-cutting

  • Validation strategies:

    • PCR screening and sequencing to confirm edits

    • RT-qPCR to assess expression changes

    • Western blotting for tagged protein variants

    • Phenotypic assays based on predicted function

  • Technical optimization for telomeric regions:

    • Telomeric regions can be challenging for CRISPR editing due to heterochromatin

    • Consider temporarily disrupting silencing factors (e.g., sir2Δ backgrounds)

    • Test multiple sgRNAs targeting different sites within YFR056C

    • Optimize transformation methods specific for subtelomeric targets

When implementing CRISPR-Cas9 for YFR056C, special attention should be paid to its genomic context since its location near telomeric regions may affect editing efficiency .

What are the most effective approaches for studying protein-protein interactions involving YFR056C?

To comprehensively characterize protein-protein interactions involving YFR056C:

  • Complementary methodological framework:

    MethodAdvantagesLimitationsBest Application
    Yeast two-hybridHigh-throughput screeningFalse positives/negativesInitial interaction discovery
    Affinity purification-MSCaptures complexes in native contextMay miss transient interactionsCore complex identification
    BioID/TurboIDDetects proximity in living cellsIdentifying nearby proteinsSpatial interactome mapping
    FRET/BRETReal-time interaction dynamicsRequires fluorescent tagsInteraction kinetics studies
    Co-immunoprecipitationValidates specific interactionsAntibody limitationsConfirmation of direct interactions
    Split-protein complementationIn vivo validationMay stabilize weak interactionsVisualizing interactions in cells
  • Specialized approaches for telomeric proteins:

    • ChIP-reChIP to detect co-occupancy at chromatin regions

    • Sequential IPs to isolate specific subcomplexes

    • Proximity-dependent labeling specifically at telomeres

    • Consider Sir-protein interactions due to YFR056C's telomeric location

  • Protein domain mapping:

    • Create truncated variants to identify interaction domains

    • Use peptide arrays to pinpoint specific binding motifs

    • Perform mutagenesis of predicted interaction surfaces

    • Test effects of post-translational modifications on interactions

  • Quantitative interaction analysis:

    • Implement surface plasmon resonance or isothermal titration calorimetry

    • Determine binding kinetics and affinities

    • Assess competition between different interaction partners

    • Evaluate environmental influences (pH, salt, temperature) on binding

  • Functional validation:

    • Confirm biological relevance of interactions through genetic approaches

    • Test if deleting interaction partners affects YFR056C function

    • Create separation-of-function mutations that specifically disrupt individual interactions

    • Analyze epistatic relationships between YFR056C and interactors

Remember to integrate interaction data with existing information about YFR056C's subtelomeric location and potential involvement in telomeric silencing .

How can YFR056C research contribute to our understanding of telomeric regulation in eukaryotes?

YFR056C research can significantly advance our understanding of telomeric regulation in eukaryotes through:

  • Boundary element mechanisms:

    • YFR056C's location places it at potential chromatin boundary regions

    • Studies could reveal novel mechanisms for separating heterochromatin from euchromatin

    • Comparison with known boundary elements like tRNA genes and Rpd3-dependent boundaries may reveal evolutionary conservation

  • Comparative genomics approach:

    OrganismTelomeric StructureResearch ValueConnection to YFR056C
    S. cerevisiaeRelatively simple telomeresModel for basic mechanismsDirect homology
    S. pombeComplex heterochromatinAlternative silencing mechanismsFunctional analogs
    Mammalian cellsLong telomeres with shelterinMedical relevanceConserved principles
    Other fungiDiverse telomeric arrangementsEvolutionary insightsDegree of conservation
  • Integration with telomere maintenance pathways:

    • Investigate potential roles in telomerase regulation

    • Study interactions with the Sir protein complex

    • Examine relationships with histone modifying enzymes like Rpd3 and Sas2

    • Assess impact on telomere position effect and gene silencing

  • Heterochromatin spreading mechanisms:

    • YFR056C could function in regulating heterochromatin spreading

    • Research could reveal dynamic aspects of boundary formation

    • May provide insights into Sir3 protein spreading observed in various chromatin contexts

    • Could connect to broader epigenetic regulation mechanisms

  • Translational research potential:

    • Understanding telomeric regulation has implications for aging and cancer

    • YFR056C research may reveal conserved mechanisms applicable to human disease

    • Could identify new therapeutic targets for telomere-related disorders

    • May connect to previously unrecognized aspects of genome stability

This research direction has particular value given the observation that YFR056C expression is affected by Sir-dependent mechanisms and may be involved in chromatin boundary dynamics at telomeres .

What are emerging technologies that could accelerate functional characterization of YFR056C?

Emerging technologies that could revolutionize YFR056C characterization include:

  • Advanced genome editing approaches:

    • Prime editing for precise modifications without double-strand breaks

    • Base editing for specific nucleotide changes

    • CRISPR activation/interference (CRISPRa/CRISPRi) for modulating expression without DNA modification

    • Multiplexed editing to simultaneously modify YFR056C and potential interactors

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in YFR056C expression

    • Single-cell proteomics to detect cell-to-cell variation in protein levels

    • Single-cell epigenomics to map chromatin states at the YFR056C locus

    • Live-cell imaging with advanced microscopy techniques

  • Spatial biology methods:

    TechnologyApplicationAdvantage for YFR056C Research
    Super-resolution microscopyPrecise localizationVisualize telomeric positioning
    Spatial transcriptomicsGene expression in contextMap expression relative to nuclear landmarks
    Proximity labelingIn situ interaction mappingIdentify neighbors in telomeric regions
    4D nucleome mappingChromatin organization over timeTrack dynamics of telomeric regions
  • Protein structure and function technologies:

    • AlphaFold2 and RoseTTAFold for accurate structure prediction

    • Cryo-EM for complex structural determination

    • High-throughput protein engineering with deep mutational scanning

    • Cell-free protein synthesis for rapid functional testing

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position YFR056C in cellular pathways

    • Mathematical modeling of telomeric silencing incorporating YFR056C

    • Machine learning for predicting phenotypic outcomes of YFR056C perturbations

These technologies can help overcome challenges associated with studying proteins in telomeric regions, where traditional approaches may be limited due to heterochromatin formation and position effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.