Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL024W (YGL024W)

Shipped with Ice Packs
In Stock

Description

Molecular and Genomic Context

YGL024W is annotated as a dubious ORF in the Saccharomyces cerevisiae genome, overlapping antisense to the verified gene PGD1 on chromosome VII . Key characteristics include:

  • Gene locus: YGL024W (chromosome VII)

  • Protein length: 111 amino acids (predicted molecular weight: ~12.5 kDa)

  • Sequence: Available via SGD (Accession: P53190)

Table 1: Recombinant YGL024W Products

Host SystemPurityApplicationsSupplier
E. coli≥85%ELISA, WBMyBioSource
Cell-Free Expression≥85%Structural studiesCreative BioMart
Mammalian Cells≥85%Functional assaysChemicalBook

Purification methods include SDS-PAGE verification and antigen-affinity chromatography . A His-tagged full-length variant (1–111 aa) is available for biochemical studies .

Functional Insights and Interactions

Although YGL024W is classified as non-functional, studies suggest indirect roles in cellular processes:

Table 2: Observed Genetic and Functional Interactions

Interaction TypeAssociated Genes/ProteinsBiological ContextSource
Genetic deletionASK1, SWI3, MDM34DNA repair, chromatin remodeling
ER cargo traffickingErv29p, Bst1p, Ted1pGPI-anchored protein transport
Metabolic profilingAmino acid biosynthesisAltered metabolite levels

Key findings:

  • Deletion of YGL024W disrupts ER export machinery, suggesting a regulatory role in vesicle trafficking .

  • Mutant strains show altered amino acid profiles, particularly in asparagine and glutamate metabolism .

Research Applications

Recombinant YGL024W is primarily used in:

  • Antibody production: Rabbit polyclonal antibodies against YGL024W are available for Western blotting .

  • Protein interaction studies: Yeast two-hybrid screens identify interactions with SNARE proteins and chromatin modifiers .

  • Structural biology: Cell-free expressed variants enable crystallization trials .

Controversies and Limitations

The functional relevance of YGL024W remains debated:

  • Genomic evidence: Classified as non-functional due to antisense overlap with PGD1 and lack of expression .

  • Experimental data: Observed genetic interactions and metabolic changes suggest context-dependent roles .

Future Directions

Further studies could explore:

  • Mechanistic roles: Clarify whether YGL024W regulates antisense transcription of PGD1.

  • Therapeutic potential: Leverage recombinant YGL024W in yeast-based immunotherapy platforms, akin to Ras-targeted cancer vaccines .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
YGL024W; Putative uncharacterized protein YGL024W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL024W
Target Protein Sequence
MFAIICMNSLNCNRNGRISSRASLICLHTLSLVSFSFLANITCKSSSLTPAGIIESIPVV FTAVVSVLRCLIEEVLVTVSVVLFKISLGAIPKILRKVLVLYIILYYIILY
Uniprot No.

Target Background

Database Links

STRING: 4932.YGL024W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGL024W and why is it classified as a dubious ORF?

YGL024W is classified as a dubious open reading frame (ORF) in the Saccharomyces cerevisiae genome that overlaps with and is located on the opposite strand from the verified gene PGD1 . Dubious ORFs are genomic sequences that contain apparent coding regions but are unlikely to encode functional proteins based on several criteria. In the case of YGL024W, its classification as dubious stems from its lack of conservation across related yeast species, absence of experimental evidence supporting protein expression, and its overlapping position with a verified gene.

The genomic context of YGL024W is particularly significant as it represents one of several dubious ORFs (including YGL218W, YJL175W, and YKL053W) whose deletions have been observed to mitigate protein burden effects in yeast . Genetic screening has isolated these dubious ORFs, though individual characterization of their specific mechanisms remains incompletely delineated in the literature.

How does YGL024W interact with its overlapping verified gene PGD1?

YGL024W overlaps with the verified gene PGD1 on the opposite DNA strand, creating a complex genetic architecture that complicates both the understanding of its potential function and experimental manipulations . PGD1 (also known as MED3) encodes a subunit of the Mediator complex involved in transcriptional regulation, raising questions about how perturbations to the YGL024W locus might affect PGD1 function.

Similar to the documented case of YJL175W deletion causing an N-terminal deletion of Swi3 (creating a Swi3ΔN variant), deletion of YGL024W could potentially create partial deletions or modifications of PGD1 . This structural relationship requires careful experimental design when studying either gene, as genetic manipulations targeting YGL024W may inadvertently affect PGD1 expression or function, leading to phenotypes that might be incorrectly attributed.

What molecular techniques are recommended for studying YGL024W?

For comprehensive characterization of YGL024W, researchers should employ a multi-faceted approach combining genomic, transcriptomic, and phenotypic analyses. The primary techniques include:

How can researchers distinguish between YGL024W effects and PGD1 disruption?

Distinguishing the direct effects of YGL024W from indirect effects caused by PGD1 disruption represents one of the central challenges in studying this dubious ORF. Recommended approaches include:

  • Complementation analysis: Reintroduce YGL024W on a plasmid into the deletion strain to determine if phenotypes are rescued. Similarly, express PGD1 from an ectopic location to determine if phenotypes are due to PGD1 disruption.

  • Synonymous mutations: Introduce synonymous mutations in YGL024W that preserve the PGD1 coding sequence on the opposite strand. This requires careful codon optimization to ensure changes affect YGL024W without altering PGD1.

  • Targeted promoter modifications: Modify the putative promoter region of YGL024W without affecting PGD1 to determine if reduced expression of YGL024W produces phenotypes similar to its deletion.

  • Comparison with PGD1 mutants: Create and characterize defined mutations in PGD1 to establish a phenotypic baseline that can be compared with YGL024W deletion phenotypes. Overlapping phenotypes would suggest that YGL024W deletion effects operate through PGD1 disruption.

What phenotypic assays are most informative for YGL024W functional characterization?

Based on the known effects of other dubious ORF deletions on protein burden response, the following phenotypic assays are particularly informative for YGL024W characterization:

  • Protein burden assessment: Measure growth rates and heterologous protein expression levels (e.g., GFP) in wildtype versus YGL024W deletion strains under conditions of protein overproduction. Construct growth curves as demonstrated for YJL175W deletion strains, where deletion mitigated growth defects triggered by GFP overproduction .

  • Transcription factor activity assays: Since YJL175W deletion affected transcription factor expression and activity, analyze transcription factor activities using reporter assays in YGL024W deletion strains, focusing particularly on factors regulated by the Mediator complex (of which PGD1 is a component) .

  • Secretory pathway function: Assess secretory pathway efficiency, as YJL175W deletion led to reduced expression of genes encoding secretory proteins. This can be done using secreted enzyme reporters like invertase or acid phosphatase .

  • Stress response profiling: Evaluate responses to various cellular stresses, including heat shock, oxidative stress, and protein folding stress, as changes in transcriptional regulation might alter cellular stress resistance.

How might YGL024W deletion affect global gene expression patterns?

The deletion of YGL024W likely creates complex alterations in gene expression patterns, possibly through effects on the overlapping PGD1 gene. Based on observations from YJL175W deletion, which created an N-terminal deletion of Swi3 and led to significant transcriptional changes, researchers should expect:

  • Mediator complex function alterations: If YGL024W deletion affects PGD1 function, expression changes would likely be observed in genes regulated by the Mediator complex, potentially affecting hundreds of genes across multiple biological processes.

  • Asymmetric transcriptional changes: Similar to YJL175W deletion, where more genes showed decreased rather than increased expression (230 decreased vs. 67 increased), YGL024W deletion might create an asymmetric pattern of expression changes .

  • Effects on highly expressed genes: YJL175W deletion specifically reduced expression of highly expressed, non-essential genes encoding secreted proteins. YGL024W deletion might similarly affect a specific functional category of genes, possibly those regulated by Mediator .

  • Transcription factor expression changes: The potential impacts on Mediator function could alter the expression of multiple transcription factors, creating cascading effects on their downstream targets.

What is the relationship between YGL024W and protein burden effects?

The protein burden effect refers to growth defects caused by overexpression of non-toxic proteins due to resource allocation challenges. YGL024W deletion has been identified among mutants that mitigate this effect, suggesting potential mechanisms such as:

  • Resource reallocation: Similar to YJL175W deletion, YGL024W deletion might reduce the expression of highly abundant proteins, freeing cellular resources (ribosomes, amino acids, energy) for the production of heterologous proteins .

  • Translation efficiency changes: YGL024W deletion might alter global translation dynamics, possibly by affecting polysome/monosome ratios as observed with YJL175W deletion .

  • Transcriptional reprogramming: Changes to PGD1 function could lead to transcriptional reprogramming that happens to be favorable for heterologous protein production, possibly by reducing competing endogenous protein synthesis.

  • Stress response modulation: YGL024W deletion might alter cellular stress response pathways related to protein folding and quality control, potentially making cells more tolerant to high levels of heterologous protein production.

How does the structure-function relationship of YGL024W compare to other dubious ORFs?

Understanding how YGL024W compares to other dubious ORFs provides important context for interpretation of experimental results:

  • Overlapping gene architecture: While YGL024W overlaps with PGD1, other dubious ORFs like YJL175W overlap with SWI3 and YGL218W overlaps with MDM34. These architectural similarities suggest common regulatory principles but with gene-specific consequences .

  • Partial loss-of-function effects: YJL175W deletion created a truncated Swi3 protein (Swi3ΔN) that retained some functionality through preservation of C-terminal domains. YGL024W deletion might similarly create a partial loss-of-function variant of PGD1 rather than a complete functional knockout .

  • Transcriptional consequences: While YJL175W deletion led to decreased expression of genes encoding secretory proteins, YGL024W deletion might affect different gene sets based on PGD1's role in Mediator-mediated transcription regulation .

  • Phenotypic specificity: Each dubious ORF deletion might create unique phenotypic signatures based on the specific functions of their overlapping genes, despite the common theme of mitigating protein burden effects.

How can researchers address experimental design challenges when studying YGL024W?

Studying dubious ORFs like YGL024W presents several methodological challenges that require specific solutions:

  • Precise genetic manipulation: Design deletion strategies that minimize impact on PGD1 while completely removing YGL024W. This might require multiple deletion constructs with varying endpoints to identify optimal approaches that separate YGL024W and PGD1 functions.

  • Comprehensive controls: Include multiple control strains, including wildtype, precise PGD1 mutants, and strains with synonymous mutations in YGL024W that preserve PGD1 function to distinguish between direct and indirect effects.

  • Multi-omics integration: Combine transcriptomics, proteomics, and phenotypic data to build a comprehensive picture of YGL024W deletion effects. This approach helped identify that YJL175W deletion affected both transcription and translation .

  • Time-course analyses: Monitor changes immediately following YGL024W deletion versus long-term adaptive responses to distinguish primary effects from compensatory changes.

What analytical approaches help resolve contradictory data about YGL024W?

When faced with contradictory or complex data regarding YGL024W function, researchers should employ these analytical approaches:

  • Genetic interaction mapping: Systematic analysis of genetic interactions between YGL024W deletion and other mutations can provide functional context. For example, comparing YGL024W deletion effects with PGD1 mutations across multiple conditions can reveal functional relationships.

  • Conditional expression systems: Employ inducible or repressible systems to modulate YGL024W or PGD1 expression, allowing temporal separation of effects and clearer attribution of phenotypes.

  • Single-cell analyses: Population-level measurements might mask important heterogeneity in responses to YGL024W deletion. Single-cell transcriptomics or microscopy can reveal subpopulation behaviors that explain contradictory bulk measurements.

  • Computational modeling: Develop mathematical models incorporating transcriptional and translational dynamics to predict how YGL024W deletion affects cellular resource allocation, similar to analyses performed for protein burden effects .

How can researchers distinguish between direct and indirect effects of YGL024W deletion?

Separating direct from indirect effects requires systematic experimental strategies:

  • Immediate versus delayed responses: Analyze changes immediately following YGL024W deletion (e.g., using inducible CRISPR systems) versus long-term adaptations to distinguish primary molecular events from downstream consequences.

  • Epistasis analysis: Perform epistasis experiments with mutations in PGD1 and potential downstream effectors to establish hierarchical relationships and identify the primary effectors of YGL024W deletion.

  • Targeted rescue experiments: Design rescue constructs expressing specific fragments or modified versions of PGD1 to determine which aspects of PGD1 function are most relevant to the YGL024W deletion phenotype.

  • In vitro reconstitution: Where possible, reconstitute key molecular processes in vitro to directly test hypotheses about YGL024W or its effects on PGD1 function in a controlled environment free of cellular complexity.

How does YGL024W research contribute to understanding genomic organization principles?

Research on dubious ORFs like YGL024W provides insights into fundamental principles of genome organization and evolution:

  • Overlapping gene functions: YGL024W exemplifies how genomic regions can encode information on both DNA strands, potentially creating functional constraints that influence evolutionary trajectories. This mirrors the YJL175W-SWI3 relationship, where deletion of a dubious ORF created a functional N-terminal deletion of an important regulatory protein .

  • Regulatory element architecture: The overlapping arrangement might reflect complex regulatory architectures where sequences serve multiple functions, including protein coding on one strand and regulatory elements on the other.

  • Evolutionary conservation patterns: Comparative genomics analyses across yeast species can reveal whether the YGL024W-PGD1 arrangement is conserved, providing insights into its functional significance.

  • Compact genome organization: The presence of dubious ORFs overlapping with functional genes reflects the pressure for compact genome organization in yeast, where intergenic spaces are minimized.

What technological advances would enhance YGL024W characterization?

Several emerging technologies could significantly advance our understanding of YGL024W:

  • Long-read transcriptomics: Technologies like Oxford Nanopore or PacBio sequencing would provide more accurate information about transcript structures, potentially identifying novel splicing events or isoforms relevant to YGL024W or PGD1.

  • Genome-wide CRISPR screens: Systematic CRISPR interference or activation screens targeting the YGL024W locus with single-nucleotide precision could help identify functional elements within this region without complete deletion.

  • Ribosome profiling: High-resolution ribosome profiling could definitively determine whether YGL024W is actually translated in vivo under any conditions, resolving questions about its protein-coding potential.

  • Chromatin conformation capture: Techniques like Hi-C or Micro-C could reveal whether the YGL024W-PGD1 locus participates in important chromosomal interactions that might be disrupted by YGL024W deletion.

How can YGL024W research inform synthetic biology applications?

The study of YGL024W and similar dubious ORFs has practical implications for synthetic biology:

  • Improving heterologous protein production: Understanding how YGL024W deletion mitigates protein burden effects could lead to engineered yeast strains with enhanced capacity for recombinant protein production, similar to the benefits observed with YJL175W deletion .

  • Genome streamlining strategies: Insights from YGL024W studies could inform strategies for minimal genome design, identifying genomic regions that can be modified to optimize resource allocation without compromising cellular fitness.

  • Transcriptional engineering: If YGL024W deletion affects Mediator function through PGD1, this knowledge could be leveraged to design transcriptional circuits with predictable outputs for synthetic biology applications.

  • Novel regulatory elements: The YGL024W locus might contain regulatory elements that could be repurposed as parts for synthetic gene circuits, particularly if they influence expression of the overlapping PGD1 gene.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.