Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL041C (YGL041C)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL041C (YGL041C) is a protein derived from the budding yeast Saccharomyces cerevisiae. Designated as a dubious open reading frame, it is currently annotated as unlikely to encode a functional protein based on experimental and comparative sequence analyses . Despite this classification, recombinant versions of YGL041C are commercially available for research purposes, suggesting ongoing interest in its potential biological roles .

Expression and Purification

ParameterValue
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE) ; >90% (His-tagged constructs)
TagsHis-tag (N-terminal) ; Other tags available (e.g., cell-free systems)
FormLyophilized powder or solution (Tris/PBS-based buffer, 6% trehalose)

Recombinant YGL041C is typically expressed as a full-length protein with a His-tag for affinity purification. Partial constructs (e.g., truncated variants) are also available for specialized studies .

Genetic Deletion Studies

The YGL041C knockout strain (BY4743 background) shows altered amino acid metabolism under exponential growth in minimum synthetic medium. Key findings include:

  • Significant changes in free amino acid profiles, indicating potential involvement in biosynthetic pathways .

  • Metabolic clustering with genes affecting amino acid homeostasis, suggesting a regulatory role in metabolism .

Metabolic ProfileObserved Changes
Amino Acid HomeostasisMultivariate (χ²-test) and univariate (Z-test) changes in amino acid levels
Functional GroupingClustered with genes influencing biosynthetic metabolism

Experimental Resources

Resource TypeDescription
Recombinant ProteinsFull-length and partial variants; His-tagged for purification
AntibodiesRabbit polyclonal antibodies for ELISA and Western blot
Knockout StrainsYPD broth + G418 (200 µg/mL) for genetic studies

Example Application:

  • ELISA/WB Detection: Antibodies targeting YGL041C enable protein quantification and localization .

  • Metabolic Studies: Knockout strains facilitate phenotypic analysis under controlled growth conditions .

Limitations and Uncertainties

  • Functional Ambiguity: Classified as a dubious ORF, with limited evidence for protein function .

  • Sequence Discrepancies: Native protein length conflicts between sources (68 aa vs. 104 aa in recombinant constructs) .

Research Priorities

  1. Interaction Mapping: Identify binding partners to elucidate potential roles in cellular processes.

  2. Pathway Integration: Validate metabolic cluster associations (e.g., amino acid biosynthesis) .

  3. Structural Characterization: Solve crystal/NMR structures to assess functional potential.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag type.
Synonyms
YGL041C; Putative uncharacterized protein YGL041C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL041C
Target Protein Sequence
MPDFSNSNLNSFIACLRSLSIKILIICHGFIVFSSLAEVPSRLTNFFSIMILLTFSNFSQ NIRPRIYLIHEFLHLYVCIYFVIRLSVVPRLSVKSSRRNPGKPP
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGL041C and what is currently known about its function?

YGL041C is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast) whose precise biological function remains to be fully elucidated. Current research suggests it may be involved in cellular stress responses, particularly in relation to weak acid stress. The protein has been identified through genomic sequencing and computational analysis, but functional characterization remains incomplete. Recent studies have begun investigating potential roles in cell wall structure and pH homeostasis through association with stress response pathways .

To study this protein effectively, researchers typically use a combination of bioinformatic analysis, gene deletion studies, and recombinant protein expression systems. Computational analysis using methodologies such as the Z curve theory can help predict coding potential and provide insights into structural characteristics .

What expression systems are most effective for recombinant YGL041C production?

For laboratory-scale production of recombinant YGL041C, multiple expression systems have been employed with varying degrees of success. The primary considerations should include protein folding, post-translational modifications, and functional activity. The following table summarizes key expression systems and their characteristics:

Expression SystemAdvantagesLimitationsRecommended Use Case
E. coli (BL21(DE3))Rapid growth, high yield, simple methodologyMay lack proper folding, no post-translational modificationsStructural studies, antibody production
S. cerevisiae (native)Native post-translational modifications, proper foldingLower yield than bacterial systemsFunctional studies, protein interaction analysis
Insect cell lines (Sf9, Sf21)Eukaryotic processing, high expressionMore complex protocols, higher costComplex protein studies requiring eukaryotic modifications
Mammalian cells (293T, CHO)Full range of post-translational modificationsHighest complexity, lower yield, expensiveStudies requiring mammalian-specific modifications

For most academic research applications focusing on YGL041C's basic characterization, expression in its native host (S. cerevisiae) often provides the most physiologically relevant results, despite potentially lower yields compared to heterologous systems .

How can I verify the identity and purity of recombinant YGL041C?

Identity and purity verification of recombinant YGL041C requires a multi-method approach. Begin with SDS-PAGE to assess protein size and initial purity. Western blotting using antibodies specific to YGL041C or to fusion tags (such as His, FLAG, or GST) provides confirmation of identity. For higher confidence, mass spectrometry analysis comparing peptide fragments to theoretical predictions offers definitive identification.

Purity assessment should employ multiple techniques including:

  • Size-exclusion chromatography to detect aggregates or degradation products

  • Reverse-phase HPLC for contaminant detection

  • Dynamic light scattering to evaluate homogeneity

  • Endotoxin testing if intended for cellular applications

Aim for >95% purity for most research applications, though >90% may be sufficient for preliminary studies. Document batch-to-batch variation and establish acceptance criteria based on your specific experimental requirements .

What are the optimal conditions for analyzing YGL041C expression in response to environmental stress?

When analyzing YGL041C expression under stress conditions, experimental design should account for multiple factors affecting gene regulation and protein production. Research suggests potential involvement of YGL041C in stress responses similar to RIM101 pathway components, particularly in weak acid stress conditions:

  • Temperature: Standard incubation at 30°C for S. cerevisiae, with stress conditions ranging from 4°C to 37°C

  • pH: Test range from pH 2.5 to 8.0, with particular attention to pH 4.0 where weak acid stress responses are often studied

  • Media composition: YPD (standard rich medium) versus minimal media with different carbon sources

  • Stressors: Include propionic acid (0.1-150 mM), other weak acids (lactic, acetic, sorbic), and osmotic stressors (NaCl, sorbitol)

  • Time course: Measure expression at multiple timepoints (15 min, 30 min, 1 hr, 2 hr, 4 hr, 8 hr)

RNA extraction should be performed using methods optimized for yeast, followed by RT-qPCR with primers specifically designed for YGL041C. For protein-level analysis, use antibodies against YGL041C or epitope tags in Western blotting. Always include appropriate housekeeping genes (ACT1, TAF10) as internal controls and the RIM101 pathway genes for comparison .

How can I design effective gene deletion or disruption experiments to study YGL041C function?

Designing effective gene deletion experiments for YGL041C requires careful planning to ensure specific targeting and proper validation. Consider the following methodological approach:

  • Strategy selection: CRISPR-Cas9 offers precision but may introduce off-target effects. Traditional homologous recombination with selection markers remains reliable for S. cerevisiae.

  • Construct design: Include 40-60 bp homology arms flanking YGL041C for homologous recombination. When designing deletion cassettes, preserve regulatory elements of adjacent genes to prevent unintended effects.

  • Transformation protocol: Use lithium acetate method optimized for S. cerevisiae, with heat shock at 42°C for 40 minutes.

  • Validation methods:

    • PCR verification using primers outside the targeted region

    • Southern blotting for confirmation of single integration

    • RT-PCR to confirm absence of YGL041C transcripts

    • Western blotting to confirm protein absence

  • Control strains: Include wild-type, heterozygous deletion (if diploid strain), and complementation strains (reintroducing YGL041C under native or inducible promoter).

For phenotypic characterization, systematically evaluate growth under various conditions, particularly focusing on weak acid stress tolerance, cell wall integrity (using calcofluor white or congo red sensitivity), and vacuolar pH (using quinacrine staining), based on potential functional connections to the RIM101 pathway .

What approaches can be used to identify potential protein interaction partners of YGL041C?

Identifying protein interaction partners of YGL041C requires complementary approaches to build confidence in results. Consider implementing the following methods:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express YGL041C with affinity tags (e.g., TAP-tag, FLAG-tag)

    • Perform gentle cell lysis to preserve interactions

    • Capture complexes using appropriate affinity matrices

    • Identify partners through mass spectrometry

    • Distinguish true interactors from contaminants using statistical methods like SAINT or CompPASS

  • Yeast two-hybrid (Y2H) screening:

    • Create bait constructs with YGL041C fused to DNA-binding domain

    • Screen against prey library of S. cerevisiae proteins

    • Validate positive interactions with secondary assays

    • Consider membrane-based Y2H systems if YGL041C has membrane associations

  • Proximity-dependent labeling (BioID or APEX):

    • Express YGL041C fused to biotin ligase

    • Allow in vivo biotinylation of proximal proteins

    • Analyze biotinylated proteins by streptavidin pulldown and mass spectrometry

  • Co-immunoprecipitation validation:

    • Perform targeted validation of key interactions

    • Use reciprocal co-IP with both tagged proteins

    • Include appropriate controls (unrelated proteins, tag-only)

Bioinformatic analysis of results should include comparison with known interaction databases and functional annotation clustering. Pay special attention to proteins involved in stress response pathways, particularly those related to RIM101 signaling and weak acid stress response components .

How does YGL041C expression correlate with RIM101 pathway activation under weak acid stress?

Studies suggest potential functional connections between YGL041C and the RIM101 pathway in S. cerevisiae's response to weak acid stress. To investigate this correlation, a comprehensive experimental design should include:

  • Strain preparation: Create reporter strains with fluorescent protein tags for both YGL041C and key RIM101 pathway components (RIM101, RIM8, RIM20, RIM13).

  • Stress conditions: Expose cultures to varying concentrations of propionic acid (0-150 mM) at pH 4.0, which activates specific stress responses without triggering general acid stress responses.

  • Time-course analysis: Monitor expression at defined intervals (15 min to 8 hours) using:

    • RT-qPCR for transcript levels

    • Western blotting for protein levels

    • Fluorescence microscopy for localization changes

    • Flow cytometry for population-level quantification

  • Genetic manipulations: Compare wild-type responses with:

    • ΔRIM101 strains to observe YGL041C behavior without RIM101

    • ΔYGL041C strains to observe RIM101 pathway behavior

    • Double mutants to assess potential epistasis

Data analysis should employ Pearson or Spearman correlation coefficients to quantify relationships between expression patterns. The temporal sequence of expression changes can provide insights into regulatory relationships—whether YGL041C is upstream, downstream, or parallel to RIM101 signaling.

Research indicates the RIM101 pathway is required for maximal tolerance to weak acid-induced stress at pH 4.0, and may regulate several previously unidentified target genes, potentially including YGL041C. The pathway appears to be important for counteracting propionic acid-induced cytosolic acidification and for proper vacuolar acidification and cell wall structure .

What computational approaches can predict structural and functional features of YGL041C?

Advanced computational analyses can offer valuable insights into YGL041C's potential functions before extensive laboratory characterization. Implement the following multi-layered approach:

  • Sequence-based predictions:

    • Apply the Z curve method, which transforms DNA sequence into a three-dimensional curve where coding and non-coding regions show distinct distribution patterns

    • Calculate the YZ score, defined as (F(u)-Fmin-)/(Fmax+-Fmin-), where values above 0.5 suggest coding potential

    • Use position-specific scoring matrices to identify conserved motifs

  • Structural predictions:

    • Employ machine learning algorithms like AlphaFold2 for tertiary structure prediction

    • Identify potential transmembrane regions and signal peptides

    • Analyze secondary structure propensities (alpha-helices, beta-sheets)

    • Predict intrinsically disordered regions that may be involved in interactions

  • Functional annotation:

    • Apply gene ontology enrichment analysis of proteins with similar domains

    • Conduct comparative genomics across related yeast species

    • Identify potential post-translational modification sites

    • Perform docking simulations with candidate interaction partners

  • Integration of multi-omics data:

    • Correlate expression patterns across publicly available transcriptomic datasets

    • Analyze co-expression networks to identify functionally related genes

    • Incorporate proteomic data on abundance and localization

The Z curve methodology has been particularly effective for identifying protein-coding genes in yeast genomes with better than 95% accuracy. For YGL041C analysis, the Fisher discriminant algorithm applied to the 10-dimensional vector derived from the Z curve provides a robust framework for prediction .

How can researchers address contradictory data when characterizing YGL041C function?

  • Data validation and quality assessment:

    • Reexamine raw data for technical anomalies or outliers

    • Verify reagent quality, including antibody specificity and strain genotypes

    • Review statistical analyses for appropriate power and test selection

    • Implement blinded experimental design when possible

  • Experimental context considerations:

    • Evaluate strain background differences (laboratory vs. wild strains)

    • Assess media composition variations and growth conditions

    • Compare acute vs. chronic stress responses

    • Consider cell-to-cell heterogeneity using single-cell approaches

  • Hypothesis refinement:

    • Develop alternative models that accommodate seemingly contradictory results

    • Design critical experiments that specifically differentiate between competing hypotheses

    • Consider context-dependent functions or condition-specific activities

  • Methodological triangulation:

    • Apply orthogonal techniques to measure the same parameters

    • Utilize both in vivo and in vitro approaches

    • Combine genetic, biochemical, and imaging methodologies

When analyzing unexpected results, maintain scientific rigor by thoroughly examining data for discrepancies and evaluating initial assumptions. Consider alternative explanations for contradictory findings, which may lead to refinement of hypotheses or discovery of context-dependent functions. Document all approaches systematically, including unsuccessful attempts, to provide comprehensive research context .

What statistical approaches are most appropriate for analyzing YGL041C expression data across different experimental conditions?

When analyzing YGL041C expression data across multiple conditions, researchers should implement condition-appropriate statistical methods that account for the specific characteristics of the experimental design:

  • For RT-qPCR expression data:

    • Normalize against multiple reference genes (ACT1, TAF10, ALG9) using algorithms like geNorm or NormFinder

    • Apply the 2^-ΔΔCT method for relative quantification

    • Use ANOVA with post-hoc tests (Tukey's HSD) for multiple condition comparisons

    • Implement linear mixed models when incorporating random effects

  • For time-course experiments:

    • Apply repeated measures ANOVA when assumptions are met

    • Consider non-parametric alternatives when data violate normality assumptions

    • Use longitudinal data analysis methods for complex time-dependent patterns

  • For RNA-seq data:

    • Implement DESeq2 or edgeR for differential expression analysis

    • Account for batch effects using ComBat or similar approaches

    • Apply FDR correction for multiple testing (Benjamini-Hochberg)

    • Consider time-course RNA-seq-specific tools for temporal analysis

  • For proteomics data:

    • Normalize using global scaling or probabilistic quotient normalization

    • Use appropriate tests based on data distribution (parametric or non-parametric)

    • Apply dimension reduction techniques to identify patterns across multiple proteins

The following table summarizes statistical test selection based on experimental design:

Experimental DesignRecommended Primary AnalysisSecondary/Validation Analysis
Two conditions, single timepointStudent's t-test or Mann-WhitneyBootstrap analysis
Multiple conditions, single timepointOne-way ANOVA with post-hoc testsKruskal-Wallis (non-parametric)
Two conditions, multiple timepointsRepeated measures ANOVAMixed-effects models
Multiple conditions, multiple timepointsTwo-way ANOVA with repeated measuresGeneralized additive models
Dose-response experimentsNon-linear regression analysisBootstrapped confidence intervals

For all analyses, report effect sizes alongside p-values to provide information about biological significance rather than merely statistical significance .

How can researchers distinguish between direct and indirect effects when studying YGL041C's role in stress response?

Distinguishing direct from indirect effects when characterizing YGL041C's role in stress response requires a multi-faceted experimental approach:

  • Temporal resolution studies:

    • Implement high-resolution time-course experiments (minutes to hours)

    • Monitor transcript and protein levels simultaneously

    • Analyze the sequence of events following stress induction

    • Apply mathematical modeling to infer causal relationships

  • Rapid induction systems:

    • Utilize chemically-inducible promoters (tetO, GAL1) to control YGL041C expression

    • Measure acute responses to sudden YGL041C expression changes

    • Compare kinetics with natural stress response activation

    • Identify immediate versus delayed downstream effects

  • Direct binding assays:

    • Perform chromatin immunoprecipitation (ChIP) to identify genomic binding sites

    • Use electrophoretic mobility shift assays (EMSA) for DNA-protein interactions

    • Implement RNA immunoprecipitation to detect RNA interactions

    • Apply protein-protein crosslinking to capture transient interactions

  • Genetic interaction analysis:

    • Construct epistasis maps through double-mutant analysis

    • Apply synthetic genetic array (SGA) methodology

    • Quantify genetic interactions using E-MAP scoring

    • Identify suppressor and enhancer relationships

  • Direct target validation:

    • Mutate potential binding sites in promoters/proteins

    • Perform directed protein evolution to generate separation-of-function alleles

    • Implement domain swapping to identify functional regions

    • Use rapamycin-induced dimerization for temporal control

This integrated approach helps create a hierarchy of effects following YGL041C activation or deletion, separating primary molecular interactions from downstream consequences. When applied to stress response studies, consider the RIM101 pathway as a comparative model, as it has established roles in propionic acid stress response through both direct transcriptional regulation and indirect effects on cell wall structure and internal pH homeostasis .

What are the best practices for interpreting high-throughput data related to YGL041C function?

  • Quality control and preprocessing:

    • Apply stringent QC metrics appropriate to each data type (RNA-seq, proteomics, etc.)

    • Document all filtering and normalization steps transparently

    • Assess technical and biological replicates separately before integration

    • Validate key findings using orthogonal techniques (e.g., RT-qPCR for RNA-seq)

  • Integrative data analysis:

    • Implement multi-omics integration approaches (WGCNA, MOFA, NMF)

    • Distinguish correlation from causation through directed experimental validation

    • Apply appropriate multiple testing corrections (Benjamini-Hochberg, Bonferroni)

    • Use dimension reduction techniques to identify major patterns (PCA, t-SNE, UMAP)

  • Network-based interpretation:

    • Construct protein-protein interaction networks around YGL041C

    • Apply pathway enrichment analysis (GO, KEGG, Reactome)

    • Identify network modules and community structures

    • Compare with existing yeast genetic interaction networks

  • Comparative genomics:

    • Evaluate YGL041C homologs across fungal species

    • Assess conservation of expression patterns and protein interactions

    • Identify species-specific versus conserved functions

    • Integrate evolutionary insights with functional data

  • Addressing data contradictions:

    • When datasets yield conflicting results, systematically evaluate potential sources of variance

    • Consider condition-specific effects and phenotypic heterogeneity

    • Implement meta-analysis approaches when multiple datasets are available

    • Distinguish technical artifacts from biological variation

For computational gene identification and characterization approaches like the Z curve method, be aware of the specific algorithm parameters—such as the threshold YZ score of 0.5 for distinguishing coding from non-coding regions. The YZ score, calculated as (F(u)-Fmin-)/(Fmax+-Fmin-), provides a normalized metric between 0 and 1, where higher scores indicate greater confidence in coding potential .

What are the most promising future research directions for understanding YGL041C function?

Based on current knowledge and emerging technologies, several high-potential research directions for YGL041C characterization include:

  • Systems-level analysis:

    • Integration of YGL041C into global stress response networks

    • Multi-omics profiling across diverse environmental conditions

    • Quantitative modeling of regulatory networks incorporating YGL041C

    • Single-cell approaches to address population heterogeneity

  • Structural biology advances:

    • Cryo-EM determination of YGL041C structure and complexes

    • Hydrogen-deuterium exchange mass spectrometry for structural dynamics

    • In-cell NMR to observe conformational changes under stress conditions

    • AlphaFold2 and other AI-driven structural prediction validation

  • Evolutionary perspectives:

    • Comparative genomics across diverse fungal lineages

    • Synthetic evolution experiments under selection for stress resistance

    • Ancestral sequence reconstruction and functional testing

    • Analysis of natural variation in YGL041C across S. cerevisiae strains

  • Applied biotechnology connections:

    • Exploration of YGL041C manipulation for improving yeast stress resistance

    • Investigation of potential roles in industrial fermentation optimization

    • Application of knowledge to related pathogenic fungi

    • Development of YGL041C-based biosensors for stress conditions

  • Integration with RIM101 pathway studies:

    • Further exploration of potential functional relationships with RIM101 signaling

    • Investigation of YGL041C's role in propionic acid resistance mechanisms

    • Analysis of contributions to cell wall structure and vacuolar function

    • Characterization in the context of broader pH and stress homeostasis

These directions should be pursued with rigorous methodological approaches, incorporating the latest technologies while maintaining focus on biological significance. The convergence of computational prediction with experimental validation will likely yield the most substantial advances in understanding YGL041C's functions and regulatory networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.