Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL042C (YGL042C)

Shipped with Ice Packs
In Stock

Description

Definition and Gene Context

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YGL042C refers to a synthetic version of the YGL042C gene product from S. cerevisiae, expressed in E. coli. This protein is annotated as a hypothetical ORF (Open Reading Frame) with no experimentally verified function, as indicated by its classification in the Saccharomyces Genome Database (SGD) . The recombinant form includes an N-terminal His-tag for purification purposes .

Gene Information

  • Locus ID: YGL042C

  • Chromosomal Position: Yeast chromosome V

  • GenBank Accession: P53181 (UniProt ID)

  • Length: 101 amino acids (full-length)

  • Expression Region: 1–101 aa

Genome-Wide Deletion Studies

YGL042C was identified in a high-throughput screen for genes affecting brome mosaic virus (BMV)-directed replication. Deletion of YGL042C reduced BMV RNA replication efficiency, suggesting a potential role in viral RNA processing or host-virus interactions .

StudyObservation
PNAS (2003) YGL042C deletion led to 21% Rluc expression (vs. wild-type), indicating reduced viral replication.
Functional ContextClustered with genes involved in RNA catabolism, membrane lipid synthesis, and ubiquitin metabolism .

Hypothetical Roles

  • Membrane-Associated Processes: Sequence motifs suggest possible involvement in membrane transport or lipid metabolism .

  • Protein Turnover: Overlap with ubiquitin-related pathways (e.g., proteasome regulation) hints at a role in protein degradation .

Experimental Uses

  • ELISA Development: Recombinant YGL042C is used as a target antigen for antibody production or protein interaction studies .

  • Functional Screening: Deletion mutants (e.g., in the yeast knockout collection) are employed to study its role in stress responses or pathogen interactions .

Limitations

  • No GO Annotations: No Gene Ontology terms are assigned to YGL042C, reflecting a lack of functional characterization .

  • No Structural Data: No X-ray crystallography or NMR studies are reported, limiting mechanistic insights .

Comparative Analysis with Related Proteins

ProteinLocusFunctionYGL042C Overlap
YGL204CYGL204CUncharacterized (His-tagged) No sequence homology
ACB1ACB1Fatty acid transport Shared cluster in BMV replication
QRI8QRI8Ubiquitin conjugation Co-clustered in proteasome pathways

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YGL042C; Putative uncharacterized protein YGL042C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL042C
Target Protein Sequence
MYIVYEYAISTNWIWLYVWLFLFLDSGCQILLRIESEQAFLSLPPIVSFALSVATLIFFY SKRISICYHMLHMYRKWSMVHPQILFAIDSKIPSSLYIYHM
Uniprot No.

Target Background

Database Links

STRING: 4932.YGL042C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGL042C and in which organism is it found?

YGL042C is a putative uncharacterized protein found in Saccharomyces cerevisiae (baker's yeast), specifically in strain ATCC 204508 / S288c, which serves as the reference genome for this organism . The designation "YGL" indicates its chromosomal location, with "Y" denoting yeast, "G" representing chromosome VII, "L" indicating the left arm of the chromosome, and "042C" representing its specific location and orientation (C for Crick strand) . This protein remains functionally uncharacterized despite the extensive genome annotation efforts in S. cerevisiae, which was the first eukaryotic organism to have its genome completely sequenced.

How was YGL042C identified in the S. cerevisiae genome?

YGL042C was identified during genome annotation efforts for S. cerevisiae. The identification of such genes has evolved over time, with newer methodologies providing stronger evidence for previously unannotated open reading frames (NORFs). One significant method used for identifying novel genes like YGL042C involved combining expression profiling and mass spectrometry techniques . In particular, studies like the one published in 2010 combined Serial Analysis of Gene Expression (SAGE) with oligonucleotide array profiling and proteomics to verify the independent transcription and translation of previously unannotated genes . This multi-faceted approach provided stronger evidence for the existence of genes that were previously overlooked due to their small size or lack of obvious homology to known genes.

What experimental tools are available for studying YGL042C?

Several experimental tools are available for studying YGL042C:

  • Antibodies: Commercial antibodies specific to YGL042C are available, such as the polyclonal antibody CSB-PA345659XA01SVG, which can be used for applications including ELISA and Western Blotting . These antibodies are raised against recombinant YGL042C protein in rabbits and are typically antigen-affinity purified for specificity .

  • Genomic resources: The Saccharomyces Genome Database (SGD) contains genomic information about YGL042C, including sequence data, annotations, and primers for PCR amplification . Researchers can access tools such as BLASTN and BLASTP for sequence comparisons, design primers for amplification, and generate restriction fragment maps .

  • Mutant strains: Various mutant alleles of YGL042C may be available through yeast genetic repositories, allowing researchers to study loss-of-function phenotypes .

  • Expression vectors: S. cerevisiae has a well-established set of expression vectors and transformation protocols that can be used for recombinant expression of YGL042C for functional studies.

What biosafety considerations apply when working with recombinant S. cerevisiae expressing YGL042C?

S. cerevisiae is generally recognized as a safe organism with minimal pathogenic potential, making it suitable for routine laboratory research without extensive biosafety precautions. According to the EPA risk assessment, S. cerevisiae:

  • Has an extensive history of safe use in food production and research

  • Is not considered pathogenic to microorganisms, plants, or animals

  • Has been reported only rarely as an opportunistic pathogen in severely immunocompromised individuals

  • Does not carry virulence factors to humans or animals

  • Using appropriate containment measures to prevent environmental release

  • Properly decontaminating waste materials before disposal

  • Following standard laboratory safety procedures for handling microorganisms

The EPA has recommended S. cerevisiae for tiered exemption in biosafety regulations due to its established safety record .

What approaches can be used to predict the function of uncharacterized proteins like YGL042C?

Elucidating the function of uncharacterized proteins like YGL042C requires multiple complementary approaches:

  • Computational prediction:

    • Sequence homology searches against characterized proteins using BLASTP

    • Structural prediction tools to identify potential functional domains

    • Phylogenetic analysis to identify orthologs in other species that may be better characterized

    • Gene neighborhood analysis to identify functionally related genes based on chromosomal proximity

  • Expression pattern analysis:

    • Transcriptomic profiling under various conditions to identify correlation with known functional pathways

    • Co-expression network analysis to identify genes with similar expression patterns that may share functions

    • Stress response profiling to determine conditions that alter YGL042C expression

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify protein binding partners

    • Co-immunoprecipitation followed by mass spectrometry to identify protein complexes containing YGL042C

    • Protein array screening to identify potential interactions with known proteins or substrates

  • Genetic approaches:

    • Generation of knockout/knockdown strains to observe phenotypic effects

    • Synthetic lethality screening to identify genes that become essential in the absence of YGL042C

    • Overexpression studies to identify gain-of-function phenotypes

For YGL042C specifically, researchers should consider analyzing its expression profile under various growth conditions, as evidence suggests some uncharacterized genes show condition-specific expression patterns. For example, some NORFs (non-annotated open reading frames) exhibited specific induction upon growth in certain media or following treatments with agents like MMS or UV light .

How can protein-protein interaction studies help elucidate the function of YGL042C?

Protein-protein interaction (PPI) studies provide critical insights into the functional context of uncharacterized proteins by revealing their association with proteins of known function. For YGL042C, several methodologies can be particularly informative:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged YGL042C (e.g., FLAG, HA, or TAP tag) in S. cerevisiae

    • Purify YGL042C and associated proteins using antibody-based affinity purification

    • Identify interacting proteins via mass spectrometry

    • Compare interaction profiles under different growth conditions to identify condition-specific interactions

  • Yeast two-hybrid (Y2H) screening:

    • Use YGL042C as bait to screen against a prey library of S. cerevisiae proteins

    • Validate positive interactions with reciprocal Y2H tests and secondary methods

    • Map interaction domains by testing truncated versions of YGL042C

  • Proximity-dependent labeling:

    • Express YGL042C fused to a promiscuous biotin ligase (BioID) or peroxidase (APEX)

    • Identify proteins in close proximity to YGL042C through biotinylation followed by streptavidin pull-down and mass spectrometry

  • Co-fractionation analysis:

    • Analyze the co-elution profile of YGL042C with other proteins across multiple chromatographic separations

    • Build interaction networks based on similar elution profiles

Currently, the SGD database indicates "No interaction data available" for YGL042C , suggesting this represents a significant knowledge gap and research opportunity. Researchers should consider conducting comprehensive PPI studies as a high-priority approach to understanding YGL042C function.

What genetic manipulation strategies are most effective for studying YGL042C function?

Genetic manipulation offers powerful approaches to study the function of uncharacterized proteins like YGL042C:

  • Gene knockout/deletion:

    • Create precise YGL042C deletion strains using homologous recombination with selectable markers

    • Analyze phenotypic consequences across various growth conditions and stresses

    • Perform competitive growth assays to detect subtle fitness effects

    • Screen for synthetic lethality with other gene deletions to identify functional relationships

  • Conditional expression systems:

    • Place YGL042C under control of regulatable promoters (e.g., GAL1, MET25, or TET)

    • Study consequences of both overexpression and depletion

    • Use time-course experiments to distinguish direct from indirect effects

  • Reporter fusion constructs:

    • Create translational fusions with fluorescent proteins (GFP, mCherry) to monitor protein localization and expression dynamics

    • Use split reporter systems (e.g., split GFP or split ubiquitin) to study protein interactions in vivo

  • CRISPR-Cas9 based approaches:

    • Introduce point mutations to study specific amino acid residues

    • Create functional domain deletions while maintaining reading frame

    • Implement CRISPRi for transcriptional repression without genetic deletion

  • Systematic genetic interaction mapping:

    • Cross YGL042C deletion strain with yeast deletion collection to generate double mutants

    • Quantify genetic interactions based on growth phenotypes

    • Place YGL042C in functional context based on interaction profile similarities

For YGL042C specifically, it would be valuable to compare phenotypes under diverse growth conditions, as some novel genes show condition-specific essentiality. The study that identified new genes in S. cerevisiae found that many previously unannotated genes showed specific expression patterns under conditions like treatment with hydroxyurea, nocodazole, methyl methane sulfonate (MMS), UV light, or temperature shifts .

How can comparative genomics approaches contribute to understanding YGL042C?

Comparative genomics provides evolutionary context that can reveal functional constraints and conservation patterns for uncharacterized proteins:

  • Ortholog identification and conservation analysis:

    • Identify YGL042C orthologs across fungal species using reciprocal BLAST searches

    • Generate multiple sequence alignments to identify conserved residues under selection

    • Construct phylogenetic trees to understand evolutionary relationships

    • Compare conservation patterns with characterized protein domains

  • Synteny analysis:

    • Examine gene order conservation around YGL042C across related fungi

    • Identify consistently co-localized genes that may share functional relationships

    • Assess potential co-evolution of functionally related gene clusters

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios to identify positions under purifying or positive selection

    • Compare evolutionary rates with proteins of known function

    • Identify rapidly evolving or highly conserved domains that may indicate functional importance

  • Cross-species complementation:

    • Test if YGL042C orthologs from other fungi can complement deletion phenotypes in S. cerevisiae

    • Identify species-specific vs. conserved functions

For YGL042C, researchers should leverage the extensive genomic data available for Saccharomyces species. BLAST searches against fungal genomes (available through SGD's "BLASTN vs. fungi" and "BLASTP vs. fungi" tools ) can identify potential orthologs for comparative analysis. Additionally, the broader context of new gene identification in S. cerevisiae suggests that comparative genomics played a key role in validating previously unidentified genes, with homology to proteins in other organisms being a criterion for addition to the SGD database .

What antibody-based techniques can be used to study YGL042C?

The availability of YGL042C-specific antibodies enables multiple experimental approaches:

  • Western blotting:

    • Detect YGL042C expression levels under different conditions

    • Monitor protein processing, degradation, or post-translational modifications

    • Validate knockout or knockdown efficiency

    • Optimal protocol: Use antigen affinity-purified polyclonal antibodies (such as CSB-PA345659XA01SVG) at manufacturer-recommended dilutions, with appropriate blocking in 5% non-fat milk or BSA

  • Immunoprecipitation (IP):

    • Isolate YGL042C and associated proteins for interaction studies

    • Coupled with mass spectrometry for interactome analysis

    • Study post-translational modifications using modification-specific antibodies after IP

    • Protocol considerations: Use 2-5 μg antibody per 500 μg protein lysate, with protein A/G beads for capture

  • Chromatin immunoprecipitation (ChIP):

    • Determine if YGL042C associates with chromatin (if suspected to have DNA-binding activity)

    • Map genomic binding sites when coupled with sequencing (ChIP-seq)

    • Protocol considerations: Cross-linking with 1% formaldehyde for 10 minutes followed by sonication to generate 200-500 bp fragments

  • Immunofluorescence microscopy:

    • Determine subcellular localization of YGL042C

    • Study co-localization with known organelle markers

    • Examine localization changes under different conditions

    • Protocol considerations: Fix cells with 4% paraformaldehyde, permeabilize with 0.1% Triton X-100

  • Enzyme-linked immunosorbent assay (ELISA):

    • Quantify YGL042C levels in purified samples

    • Develop high-throughput screening assays

    • Available antibodies for YGL042C have been validated for ELISA applications

When using antibodies for YGL042C research, researchers should be aware of the specific properties of available antibodies. For example, the CSB-PA345659XA01SVG antibody is:

  • Raised in rabbits against recombinant YGL042C protein

  • Polyclonal in nature (recognizes multiple epitopes)

  • Purified by antigen affinity chromatography

  • Stored in a buffer containing 50% glycerol, 0.01M PBS (pH 7.4), and 0.03% Proclin 300 as preservative

  • Recommended to be stored at -20°C or -80°C, avoiding repeated freeze-thaw cycles

How can gene expression profiling be used to study YGL042C?

Gene expression profiling provides insights into the regulation and functional context of YGL042C:

  • RNA-Seq analysis:

    • Measure YGL042C transcript levels under different conditions

    • Identify co-regulated genes for functional inference

    • Compare expression patterns between wild-type and mutant strains

    • Experimental design: Include biological triplicates, with appropriate normalization controls

  • Quantitative PCR (qPCR):

    • Validate expression changes observed in global profiling studies

    • Monitor YGL042C expression in time-course experiments

    • Compare expression levels across different genetic backgrounds

    • Protocol considerations: Design primers spanning exon junctions if applicable, normalize to stable reference genes

  • Promoter analysis and reporter assays:

    • Clone YGL042C promoter region upstream of reporter genes (e.g., GFP, luciferase)

    • Identify regulatory elements through deletion/mutation analysis

    • Study transcription factor binding through ChIP or EMSA

    • Experimental approach: Create a series of promoter truncations to map regulatory regions

  • Single-cell RNA-Seq:

    • Examine cell-to-cell variation in YGL042C expression

    • Identify rare cell populations with distinct expression patterns

    • Study expression dynamics during cell cycle or developmental processes

Previous studies have used oligonucleotide arrays to examine the expression of novel genes in S. cerevisiae under various conditions, including treatments with hydroxyurea, nocodazole, methyl methane sulfonate (MMS), UV light, and temperature shifts . These approaches revealed that many previously unannotated ORFs showed specific expression patterns, supporting their status as genuine genes. Some NORFs exhibited significant induction under specific conditions, such as growth in glycerol-containing media, demonstrating how expression profiling can reveal condition-specific functions .

What mass spectrometry approaches are most informative for studying YGL042C?

Mass spectrometry (MS) provides powerful tools for characterizing YGL042C at the protein level:

  • Protein identification and validation:

    • Confirm the expression of YGL042C at the protein level

    • Validate the correct size and sequence of the expressed protein

    • Technique: Tryptic digestion followed by LC-MS/MS analysis

    • Similar approaches have been used to verify the translation of previously unannotated ORFs in S. cerevisiae

  • Post-translational modification (PTM) mapping:

    • Identify phosphorylation, ubiquitination, sumoylation, or other modifications

    • Quantify changes in modification status under different conditions

    • Technique: Enrichment of modified peptides (e.g., TiO2 for phosphopeptides) followed by LC-MS/MS

  • Quantitative proteomics:

    • Compare YGL042C protein levels across conditions using label-free or labeling approaches (SILAC, TMT)

    • Study protein turnover rates using pulse-chase experiments

    • Perform global proteome analysis to identify co-regulated proteins

  • Protein-protein interaction analysis:

    • Identify YGL042C interacting partners using affinity purification-mass spectrometry (AP-MS)

    • Validate and quantify interactions using targeted MS approaches

    • Characterize protein complexes using native MS or cross-linking MS

  • Structural proteomics:

    • Use hydrogen-deuterium exchange MS (HDX-MS) to study protein dynamics and ligand binding

    • Employ limited proteolysis-MS to identify structured domains

    • Apply cross-linking MS to determine spatial relationships within protein complexes

The integration of mass spectrometry with transcriptional profiling has proven valuable in identifying and validating novel genes in the S. cerevisiae genome. Research has shown that a combination of expression evidence and proteomic confirmation provides the strongest case for recognizing previously unannotated genes . For studying YGL042C, a similar multi-modal approach combining transcriptomics and proteomics would be recommended to fully characterize its expression, modifications, interactions, and potential functions.

What bioinformatic resources and tools are most valuable for YGL042C research?

Several specialized bioinformatic resources and tools can significantly enhance YGL042C research:

  • S. cerevisiae genomic databases:

    • Saccharomyces Genome Database (SGD): Primary resource for genetic and molecular information about YGL042C, including sequence data, annotation updates, and analysis tools

    • MIPS (Munich Information Center for Protein Sequences): Provides functional categorization and protein information

  • Sequence analysis tools:

    • BLASTN and BLASTP: Available directly through SGD for comparing YGL042C against other sequences

    • Multiple sequence alignment tools (Clustal Omega, MUSCLE, T-Coffee) for evolutionary analysis

    • Domain prediction tools (InterPro, SMART, Pfam) to identify functional domains

  • Gene expression databases:

    • Gene Expression Omnibus (GEO): Contains expression data for YGL042C under various conditions

    • Expression analysis tools through SGD to identify genes with similar expression patterns

  • Protein structure prediction:

    • AlphaFold or RoseTTAFold for structural prediction of YGL042C

    • PyMOL or UCSF Chimera for visualization and analysis of predicted structures

    • ConSurf for mapping evolutionary conservation onto structural models

  • Functional genomics resources:

    • BioGRID for protein-protein and genetic interaction data

    • GO (Gene Ontology) tools for functional analysis and enrichment

    • SGD for phenotype data from mutant studies

  • Yeast-specific experimental resources:

    • Primer design tools through SGD for PCR and cloning

    • Restriction fragment mapping tools for construct design

    • Yeast deletion collection database for mutant strain information

For YGL042C research, SGD provides a comprehensive starting point with access to sequence information, potential primer designs, restriction mapping tools, and links to expression databases. The database also offers a six-frame translation view that can be valuable for analyzing the coding potential of this putative uncharacterized protein . Researchers should regularly check SGD for updates to YGL042C annotation, as functional information may be added as new studies emerge.

How should researchers interpret phenotypic data from YGL042C mutant studies?

Interpreting phenotypic data from YGL042C mutant studies requires careful consideration of several factors:

  • Phenotypic specificity assessment:

    • Compare phenotypes across multiple conditions to distinguish between general fitness defects and pathway-specific effects

    • Include positive and negative control strains with known phenotypes for reference

    • Quantify phenotypic strength using appropriate metrics (e.g., growth rate, colony size, fluorescence intensity)

  • Genetic background considerations:

    • Verify phenotypes in multiple strain backgrounds to rule out background-specific effects

    • Consider the influence of secondary mutations that may have accumulated in laboratory strains

    • Be aware that S. cerevisiae S288C (the reference strain) may have different phenotypic characteristics than other commonly used laboratory strains

  • Condition-specific analysis:

    • Test under a wide range of conditions, as some gene functions are only revealed under specific stresses

    • Include carbon source variations, nutrient limitations, temperature shifts, and chemical stressors

    • Design time-course experiments to capture temporal aspects of phenotypic development

  • Functional complementation:

    • Verify phenotype causality through genetic complementation with wild-type YGL042C

    • Test domain-specific contributions by complementing with truncated or mutated versions

    • Consider cross-species complementation with orthologs to assess functional conservation

  • Integration with existing knowledge:

    • Compare YGL042C phenotypes with those of genes in relevant pathways

    • Look for phenotypic similarities with genes of known function for functional inference

    • Consider evolutionary context when interpreting phenotypic effects

When analyzing phenotypic data, researchers should be aware that non-annotated ORFs like YGL042C might have subtle phenotypes that are only detectable under specific conditions. Studies have shown that many previously unannotated genes exhibit condition-specific expression patterns , suggesting their functions may be specialized for particular environments or stress responses.

What approaches are recommended for validating potential functions of YGL042C?

Validating potential functions of uncharacterized proteins requires multiple lines of evidence:

  • Multi-level functional validation:

    • Genetic approaches: Confirm phenotypes using independently constructed mutants

    • Biochemical approaches: Verify predicted enzymatic activities or binding properties in vitro

    • Cellular approaches: Demonstrate function in the native cellular context

    • Systematic approaches: Show consistency of results across different experimental platforms

  • Functional rescue experiments:

    • Complementation with wild-type YGL042C to verify phenotype-genotype relationships

    • Structure-function analysis using mutated versions to identify critical residues

    • Heterologous expression in different cellular contexts to assess functional conservation

  • Pathway validation:

    • Epistasis analysis with genes in predicted pathways

    • Metabolomic profiling to identify changes in relevant metabolites

    • Double mutant analysis to validate genetic interactions

  • In vitro biochemical validation:

    • Purification of recombinant YGL042C for direct activity assays

    • Structural studies to confirm predicted functional domains

    • Interaction studies with predicted binding partners

  • Physiological relevance assessment:

    • Demonstrate function under naturally relevant conditions

    • Correlate molecular function with cellular or organismal phenotypes

    • Show conservation of function across different genetic backgrounds or related species

For YGL042C specifically, a multi-faceted approach is recommended given its uncharacterized status. If expression profiling suggests condition-specific regulation, researchers should focus validation efforts on those specific conditions. The integration of genetic, biochemical, and computational approaches provides the strongest case for functional assignment, as demonstrated in previous studies identifying novel genes in S. cerevisiae .

How can researchers distinguish between direct and indirect effects in YGL042C functional studies?

Distinguishing direct from indirect effects is crucial for accurate functional characterization:

  • Temporal analysis approaches:

    • Use time-course experiments to identify primary (early) versus secondary (late) effects

    • Employ inducible expression systems to monitor immediate consequences of YGL042C perturbation

    • Combine with transcriptomic or proteomic profiling to track cascading effects

  • Direct biochemical evidence:

    • Demonstrate physical interactions or enzymatic activities in purified systems

    • Use recombinant proteins and defined components to reconstitute activities in vitro

    • Apply site-directed mutagenesis to confirm specific functional residues

  • Proximity-based methods:

    • Use proximity labeling approaches (BioID, APEX) to identify proteins in direct physical contact

    • Apply FRET or BRET to verify direct protein-protein interactions in living cells

    • Employ cross-linking strategies to capture transient interactions

  • Genetic approaches:

    • Design epistasis experiments to establish pathway order

    • Use suppressor screens to identify components that can bypass YGL042C function

    • Employ rapid depletion systems (e.g., auxin-inducible degradation) to distinguish immediate effects

  • Computational network analysis:

    • Apply network modeling to predict direct versus indirect interactions

    • Use data integration across multiple experimental types to increase confidence in direct effects

    • Consider evolutionary conservation as supporting evidence for direct functional relationships

When studying uncharacterized proteins like YGL042C, researchers should be particularly cautious about functional assignments based solely on indirect evidence. For instance, expression correlation alone is insufficient to establish direct functional relationships. Multiple independent lines of evidence, preferably including direct biochemical demonstration of proposed functions, provide the strongest support for functional characterization.

What are the most promising research directions for uncharacterized proteins like YGL042C?

The study of uncharacterized proteins like YGL042C represents an important frontier in understanding the complete functional landscape of the yeast genome. Based on current knowledge and methodological capabilities, several research directions show particular promise:

  • Integrated multi-omics characterization:

    • Combining transcriptomics, proteomics, metabolomics, and interactomics data to place YGL042C in functional context

    • Using temporal profiling under multiple conditions to reveal condition-specific functions

    • Applying systems biology approaches to model YGL042C's role in cellular networks

  • High-resolution localization and dynamics:

    • Super-resolution microscopy to determine precise subcellular localization

    • Live-cell imaging with fluorescent tags to track dynamics under different conditions

    • Correlative light and electron microscopy to relate localization to ultrastructural context

  • Systematic genetic interaction mapping:

    • Genome-wide genetic interaction screens to place YGL042C in functional pathways

    • Chemical-genetic profiling to identify conditions that reveal YGL042C function

    • Synthetic genetic array analysis to systematically map genetic relationships

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography to determine YGL042C structure

    • Structure-guided functional studies to test specific hypotheses

    • Computational modeling of interactions with predicted partners

  • Evolutionary functional discovery:

    • Comparative analysis across fungal species to identify conserved features

    • Investigation of condition-specific roles in different ecological niches

    • Exploration of potential roles in adaptation to specific environmental challenges

The successful functional characterization of uncharacterized proteins requires persistence and methodological creativity. Studies that identified previously unannotated genes in S. cerevisiae demonstrate the value of integrating multiple evidence types, from expression data to protein detection and comparative genomics . This multi-disciplinary approach stands as the most promising path forward for elucidating the functions of proteins like YGL042C.

What technological advances might facilitate future studies of YGL042C?

Emerging technologies offer new opportunities for studying uncharacterized proteins:

  • Advanced genome editing technologies:

    • CRISPR-based screens for high-throughput functional genomics

    • Base editing for precise nucleotide substitutions without double-strand breaks

    • Multiplexed genome engineering for combinatorial genetic analysis

  • Single-cell and spatial technologies:

    • Single-cell proteomics to capture cell-to-cell variation in YGL042C expression and function

    • Spatial transcriptomics and proteomics to relate YGL042C function to subcellular compartments

    • Multimodal single-cell analysis combining genomic, transcriptomic, and proteomic data

  • Protein engineering and synthetic biology:

    • Optogenetic and chemogenetic tools for temporal control of YGL042C function

    • Engineered binding partners to manipulate interaction networks

    • Synthetic pathway reconstruction to test functional hypotheses

  • Advanced imaging technologies:

    • Live-cell single-molecule tracking to follow YGL042C dynamics

    • Expansion microscopy for enhanced spatial resolution

    • Label-free imaging techniques for studying native proteins

  • Computational and AI approaches:

    • Deep learning for improved protein structure and function prediction

    • Network inference algorithms to predict functional relationships

    • Integrative modeling of multi-omics data for functional discovery

  • Advanced mass spectrometry:

    • Top-down proteomics for analysis of intact proteins and their modifications

    • Ion mobility-mass spectrometry for structural characterization

    • Targeted proteomics for precise quantification of low-abundance proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.