Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL072C (YGL072C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YGL072C; Putative uncharacterized protein YGL072C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL072C
Target Protein Sequence
MGAGIFFSSLCALRDQLREHTILNDYIRYLMTLPCVLFLSSFGQAVIVVLCRVLYFDYSR FRYFLHKSFLSVLGRRVGLGGITVVIKAWQVITHFSVFSGAELYIGGHPCTSLTSVIVV
Uniprot No.

Target Background

Database Links

STRING: 4932.YGL072C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the current state of knowledge about YGL072C in Saccharomyces cerevisiae?

YGL072C is classified as a putative uncharacterized protein in the yeast Saccharomyces cerevisiae. Current research suggests it may be involved in cellular responses to stress conditions, particularly during exposure to toxic metabolites. Genome-wide screening has identified YGL072C among genes potentially associated with resistance to secondary fungal metabolites like gliotoxin . While its precise function remains undefined, it appears to be part of a broader network of proteins involved in cellular detoxification and stress response mechanisms in yeast.

Which biological processes is YGL072C potentially involved in?

Based on limited available data, YGL072C potentially functions in one or more of the following processes:

  • Cellular detoxification pathways

  • Stress response mechanisms

  • Protection against reactive species

  • Maintenance of genome integrity

Studies investigating genes with unknown functions in S. cerevisiae have implicated YGL072C in stress-related responses, particularly when yeast cells are exposed to toxic compounds . This suggests the protein may play a role in cellular protection mechanisms, though detailed characterization remains incomplete.

How is YGL072C gene expression regulated in different environmental conditions?

While specific regulation of YGL072C expression has not been comprehensively characterized, research on S. cerevisiae stress responses provides context for understanding potential regulatory mechanisms. Like other stress-responsive genes in yeast, YGL072C expression may be regulated through:

  • Stress-response elements in its promoter region

  • Transcription factors activated during specific stress conditions

  • Post-transcriptional regulation mechanisms

Experimental approaches to determine YGL072C regulation would include RNA-seq analysis under various stress conditions, promoter analysis, and chromatin immunoprecipitation studies to identify transcription factors binding to its regulatory regions.

What experimental systems are most appropriate for studying YGL072C function?

The most appropriate experimental systems for studying YGL072C include:

  • Gene deletion studies (creating Δygl072c strains) to observe phenotypic effects

  • Fluorescent tagging for localization studies

  • Overexpression systems to identify gain-of-function phenotypes

  • Yeast two-hybrid screens to identify protein interaction partners

  • Comparative analysis with other organisms using ortholog identification approaches

S. cerevisiae provides an excellent model system due to its genetic tractability and the extensive genetic tools available, including the ability to easily create knockout strains through homologous recombination as demonstrated in studies of other yeast proteins .

How does YGL072C potentially interact with known stress response pathways in S. cerevisiae?

Based on studies of similar uncharacterized proteins in yeast, YGL072C may interact with established stress response pathways through:

  • Direct protein-protein interactions with known stress response components

  • Participation in protein complexes activated during specific stress conditions

  • Functional redundancy with other stress-responsive proteins

  • Post-translational modifications triggered during stress response

To investigate these potential interactions methodologically, researchers should:

  • Perform co-immunoprecipitation experiments with tagged YGL072C to identify interacting partners

  • Conduct genetic interaction studies by creating double knockouts with known stress response genes

  • Use phosphoproteomics to identify stress-induced modifications

  • Compare phenotypes of YGL072C mutants with those of characterized stress response pathway mutants

What are the predicted structural features of YGL072C and how might they inform function?

While specific structural data for YGL072C is limited, computational prediction approaches reveal:

Structural FeaturePredictionPotential Functional Implication
Protein domainsNo clearly identified conserved domainsNovel functional mechanism
Secondary structureMix of α-helices and β-sheetsPossible enzymatic or binding function
Subcellular localizationPredicted cytoplasmic with possible membrane associationMay function in cytoplasmic stress response or membrane-associated processes
Post-translational modification sitesSeveral predicted phosphorylation sitesPotential regulation through phosphorylation cascades

Methodologically, researchers should combine computational prediction with experimental approaches:

  • Express and purify the recombinant protein for structural studies (X-ray crystallography or cryo-EM)

  • Perform targeted mutagenesis of predicted functional residues

  • Use protein modeling tools to identify potential binding pockets or catalytic sites

  • Compare structural predictions with characterized proteins that respond to similar stressors

How might YGL072C function in the context of reactive carbonyl species (RCS) stress response?

Current research on S. cerevisiae stress response proteins, particularly the DJ-1 family members (Hsp31, Hsp32, Hsp33, and Hsp34), provides a framework for investigating YGL072C's potential role in RCS detoxification:

  • The DJ-1 paralogs in yeast function as enzymes that scavenge toxic metabolites like glyoxal and methylglyoxal

  • Loss of these proteins stimulates chronic glycation of proteins and nucleic acids, inducing genetic mutations

  • YGL072C may function in parallel or complementary pathways to these known detoxification mechanisms

To investigate this potential function methodologically:

  • Expose Δygl072c strains to RCS compounds and measure survival rates

  • Assess protein and DNA glycation levels in Δygl072c compared to wild-type and DJ-1 paralog mutants

  • Measure changes in RCS levels in cells overexpressing YGL072C

  • Perform genetic interaction studies between YGL072C and known RCS detoxification genes

What approaches should be used to identify genetic interactions between YGL072C and other yeast genes?

To comprehensively map genetic interactions of YGL072C:

  • Synthetic genetic array (SGA) analysis:

    • Create a Δygl072c query strain and cross it with the yeast deletion collection

    • Score genetic interactions based on colony size/growth rate of double mutants

    • Identify both negative (synthetic sickness/lethality) and positive (suppression) genetic interactions

  • Dosage-dependent genetic interactions:

    • Overexpress YGL072C in various deletion backgrounds

    • Identify suppressors and enhancers of YGL072C overexpression phenotypes

  • Chemical-genetic profiling:

    • Expose the Δygl072c strain to a library of compounds

    • Identify conditions where Δygl072c shows increased sensitivity or resistance

    • Compare chemical-genetic profiles with those of characterized genes to identify functional relationships

  • Transcriptional profiling:

    • Compare gene expression profiles between wild-type and Δygl072c strains

    • Identify genes with altered expression as potential functional partners

What are the optimal conditions for expressing and purifying recombinant YGL072C protein?

Based on successful approaches with other yeast proteins:

  • Expression system selection:

    • E. coli BL21(DE3) with codon optimization for heterologous expression

    • S. cerevisiae expression systems for native folding and post-translational modifications

    • Insect cell expression for complex eukaryotic proteins

  • Purification strategy:

    • Affinity tags: His6, GST, or MBP fusion proteins

    • Sequential chromatography: affinity chromatography followed by size exclusion

    • Optimized buffer conditions to maintain stability

  • Quality control measures:

    • Western blotting to confirm identity

    • Mass spectrometry for verification

    • Dynamic light scattering to assess aggregation state

    • Circular dichroism to verify proper folding

  • Methodological considerations:

    • Test multiple expression conditions (temperature, induction time, media composition)

    • Include protease inhibitors during purification

    • Assess protein solubility and stability in different buffer systems

    • Consider tag removal if the tag may interfere with functional assays

How should researchers design knockout and complementation studies for YGL072C?

A comprehensive approach to knockout and complementation studies should include:

  • Knockout strategy:

    • Use homologous recombination to replace YGL072C with a selectable marker

    • Verify deletion by PCR and sequencing of junction regions

    • Create conditional knockouts if complete deletion proves lethal

  • Phenotypic characterization:

    • Growth assays under various stress conditions

    • Microscopic analysis for morphological changes

    • Metabolic profiling to identify biochemical alterations

    • Transcriptome analysis to identify compensatory gene expression changes

  • Complementation approach:

    • Reintroduce YGL072C under native or inducible promoter

    • Create point mutations to identify essential residues

    • Perform cross-species complementation with orthologs if identified

    • Use domain swapping to identify functional regions

  • Controls and validation:

    • Include wild-type controls in all experiments

    • Compare with phenotypes of related gene knockouts

    • Ensure proper expression of complementing constructs

    • Validate key findings with alternative experimental approaches

What considerations are important when designing localization studies for YGL072C?

To effectively determine the subcellular localization of YGL072C:

  • Tagging strategies:

    • C-terminal vs. N-terminal tagging considerations

    • Use of small tags (e.g., HA, FLAG) for immunodetection

    • Fluorescent protein fusions (GFP, mCherry) for live imaging

    • Verification that tags don't disrupt function through complementation tests

  • Microscopy approaches:

    • Confocal microscopy for high-resolution localization

    • Time-lapse imaging to detect dynamic localization changes

    • Co-localization with known organelle markers

    • Super-resolution techniques for detailed structural information

  • Biochemical fractionation:

    • Cellular fractionation followed by Western blotting

    • Density gradient centrifugation for membrane association studies

    • Protease protection assays for topology determination

  • Stimulus-dependent localization:

    • Examine localization under various stress conditions

    • Test effects of metabolic state changes

    • Monitor temporal dynamics of localization during stress response

How can researchers effectively study potential post-translational modifications of YGL072C?

A comprehensive approach to studying post-translational modifications (PTMs) includes:

  • Identification methods:

    • Mass spectrometry-based proteomics for global PTM identification

    • Phosphoproteomic analysis with enrichment techniques

    • Western blotting with modification-specific antibodies

    • Radioactive labeling for specific modifications

  • Functional significance assessment:

    • Site-directed mutagenesis of modified residues

    • Phenotypic analysis of modification-deficient mutants

    • Identification of modifying enzymes through genetic screens

    • Temporal correlation of modifications with cellular responses

  • Regulatory mechanisms:

    • Determine stimulus-dependent changes in modification patterns

    • Identify enzymes responsible for adding/removing modifications

    • Assess how modifications affect protein-protein interactions

    • Determine effects on protein stability, localization, and activity

  • Methodological considerations:

    • Use appropriate phosphatase/protease inhibitors during protein extraction

    • Consider enrichment strategies for low-abundance modified forms

    • Include both positive and negative controls for each modification type

    • Validate key findings with multiple methodological approaches

How should researchers interpret phenotypic differences between wild-type and YGL072C mutant strains?

When analyzing phenotypic differences:

  • Statistical considerations:

    • Perform multiple biological replicates (minimum n=3)

    • Apply appropriate statistical tests based on data distribution

    • Control for multiple comparisons when testing numerous conditions

    • Calculate effect sizes to determine biological significance

  • Contextual interpretation:

    • Compare phenotypes with known gene deletions in related pathways

    • Consider potential compensatory mechanisms activated in knockout strains

    • Assess phenotypes across multiple growth conditions and stressors

    • Distinguish direct from indirect effects through temporal analysis

  • Validation approaches:

    • Confirm phenotypes with independently generated mutant strains

    • Perform complementation tests to verify phenotype causality

    • Use alternative methodological approaches to verify key findings

    • Test gene dosage effects through underexpression and overexpression

  • Common pitfalls to avoid:

    • Misattributing secondary mutations to YGL072C deletion

    • Overlooking subtle phenotypes that may indicate function

    • Failing to consider strain background effects

    • Overinterpreting phenotypes observed in extreme conditions only

What bioinformatic approaches can help predict YGL072C function based on limited experimental data?

Bioinformatic strategies to infer function include:

  • Comparative genomics approaches:

    • Identify orthologs across species using reciprocal BLAST analysis

    • Analyze evolutionary conservation patterns to identify functional regions

    • Examine synteny patterns that might suggest functional associations

    • Compare with S. cerevisiae clusters of orthologs (ScCOGs) from other studies

  • Network-based prediction:

    • Integrate protein-protein interaction data

    • Analyze co-expression patterns across conditions

    • Examine genetic interaction profiles

    • Use guilt-by-association to infer function from network neighbors

  • Structural prediction tools:

    • Secondary structure prediction

    • Protein fold recognition

    • Binding site and catalytic site prediction

    • Molecular dynamics simulations to identify functional conformations

  • Functional annotation approaches:

    • Gene Ontology enrichment analysis of interacting partners

    • Text mining of scientific literature for functional clues

    • Analysis of condition-specific expression patterns

    • Metabolic pathway mapping and gap analysis

How can researchers distinguish between direct and indirect effects when studying YGL072C function?

To differentiate direct from indirect effects:

  • Temporal analysis approaches:

    • Time-course experiments to determine order of events

    • Rapid induction/repression systems to identify immediate responses

    • Pulse-chase experiments for dynamic processes

    • Analysis of adaptation mechanisms over time

  • Biochemical validation:

    • In vitro reconstitution with purified components

    • Direct binding assays for potential interaction partners

    • Enzyme activity measurements for putative enzymatic functions

    • Site-directed mutagenesis to identify essential functional residues

  • Genetic dissection strategies:

    • Epistasis analysis with related pathway components

    • Suppressor screening to identify pathway relationships

    • Synthetically lethal interactions to map functional networks

    • Allele-specific interactions to confirm direct relationships

  • Multi-omics integration:

    • Correlate transcriptomic, proteomic, and metabolomic changes

    • Map altered pathways at multiple biological levels

    • Identify consensus changes across different data types

    • Model potential causal relationships based on integrated data

What approaches should be used to compare YGL072C function with its potential orthologs in other organisms?

For cross-species functional comparison:

  • Ortholog identification methods:

    • Reciprocal best BLAST hit analysis

    • Phylogenetic reconstruction to identify true orthologs

    • Domain architecture comparison

    • Analysis of conserved genomic context

  • Functional complementation:

    • Express potential orthologs in Δygl072c S. cerevisiae

    • Test rescue of phenotypes to determine functional conservation

    • Analyze chimeric proteins to identify functionally conserved regions

    • Express YGL072C in orthologous gene knockout models of other species

  • Comparative phenomics:

    • Compare knockout phenotypes across model organisms

    • Analyze condition-specific fitness effects

    • Compare interactome data across species

    • Examine expression patterns in equivalent tissues/conditions

  • Evolutionary analysis:

    • Calculate selection pressure on different protein regions

    • Identify co-evolving residues that may indicate functional sites

    • Analyze evolutionary rate to infer functional constraints

    • Map lineage-specific adaptations that may indicate functional divergence

How can researchers overcome challenges in detecting low-abundance YGL072C protein in native conditions?

Methods to enhance detection of low-abundance proteins include:

  • Enrichment strategies:

    • Tandem affinity purification with native promoter expression

    • Inducible expression systems for controlled upregulation

    • Subcellular fractionation to concentrate proteins from relevant compartments

    • Affinity capture with optimized antibodies or ligands

  • Enhanced detection methods:

    • Targeted proteomics using selected reaction monitoring (SRM)

    • Proximity ligation assays for in situ detection

    • Signal amplification methods like tyramide signal amplification

    • Advanced mass spectrometry with ion mobility separation

  • Stabilization approaches:

    • Proteasome inhibitors to prevent degradation

    • Optimized extraction buffers to maintain protein stability

    • Crosslinking methods to capture transient interactions

    • Low-temperature workflows to minimize degradation

  • Methodological considerations:

    • Compare multiple extraction methods to identify optimal conditions

    • Include positive controls at similar abundance levels

    • Optimize sample preparation to minimize protein loss

    • Consider tissue-specific or condition-specific expression patterns

What strategies can address potential redundancy between YGL072C and other genes?

To investigate functional redundancy:

  • Multiple gene deletion approaches:

    • Create double, triple, and higher-order knockout strains

    • Analyze synthetic genetic interactions quantitatively

    • Test for exacerbated phenotypes in multiple mutants

    • Identify conditions where single mutants show no phenotype but multiple mutants do

  • Overexpression studies:

    • Test if overexpression of potential redundant genes rescues Δygl072c phenotypes

    • Analyze effects of simultaneous overexpression

    • Perform dominant-negative experiments to disrupt function

  • Condition-specific analysis:

    • Screen for conditions where redundancy is minimized

    • Identify stresses that specifically require YGL072C

    • Compare expression patterns to identify differential regulation

    • Test age or cell-cycle dependent requirements

  • Biochemical specificity:

    • Compare substrate specificities of potentially redundant proteins

    • Analyze kinetic parameters to identify functional differences

    • Map interaction partners to identify unique vs. shared interactions

    • Determine subcellular localization differences that may indicate specialized functions

How should researchers design experiments to test YGL072C involvement in reactive carbonyl species (RCS) detoxification?

Based on studies of other RCS detoxification systems in yeast , experiments should include:

  • Sensitivity testing:

    • Expose Δygl072c and wild-type strains to various RCS compounds

    • Test concentration-dependent growth inhibition

    • Compare with known RCS-detoxifying gene knockouts (e.g., Δhsp31)

    • Measure survival rates under acute and chronic exposure

  • Biochemical assays:

    • Measure RCS levels in Δygl072c vs. wild-type cells

    • Assess glycation levels of proteins and DNA

    • Test if purified YGL072C has direct RCS-scavenging activity

    • Analyze changes in known RCS detoxification pathways

  • Genetic interaction studies:

    • Create double knockouts with known RCS detoxification genes

    • Test epistatic relationships to determine pathway positioning

    • Examine if YGL072C overexpression can rescue other RCS-sensitive mutants

    • Investigate transcriptional responses to RCS in the presence/absence of YGL072C

  • Molecular damage assessment:

    • Measure mutation rates in response to RCS exposure

    • Quantify protein aggregation levels

    • Assess mitochondrial function and integrity

    • Monitor DNA damage response activation

What emerging technologies could accelerate functional characterization of YGL072C?

Cutting-edge approaches for protein characterization include:

  • CRISPR-based technologies:

    • CRISPRi for tunable gene repression

    • CRISPRa for targeted activation

    • Base editing for precise amino acid substitutions

    • CRISPR screens for systematic functional analysis

  • Single-cell approaches:

    • Single-cell RNA-seq to identify cell-to-cell variability in response

    • Single-cell proteomics for protein-level analysis

    • Microfluidic approaches for dynamic single-cell assays

    • Live-cell imaging with single-molecule resolution

  • Advanced structural biology:

    • Cryo-EM for high-resolution structure determination

    • Integrative structural biology combining multiple data types

    • AlphaFold and related AI approaches for structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Systems biology integration:

    • Multi-omics data integration frameworks

    • Network modeling approaches

    • Machine learning for functional prediction

    • High-throughput automated phenotyping

How can researchers design experiments to determine if YGL072C is involved in genome integrity maintenance?

Based on findings that some S. cerevisiae stress response proteins maintain genome integrity , experimental approaches should include:

  • DNA damage assessment:

    • Measure mutation rates in Δygl072c strains

    • Quantify DNA damage markers (e.g., γ-H2AX foci)

    • Assess sensitivity to DNA damaging agents

    • Monitor chromosomal rearrangements and stability

  • DNA repair pathway analysis:

    • Test genetic interactions with known DNA repair genes

    • Measure efficiency of specific repair pathways

    • Analyze localization during DNA damage response

    • Assess recruitment to sites of DNA damage

  • Replication stress response:

    • Analyze S-phase progression in mutants

    • Measure sensitivity to replication stress agents

    • Monitor replication fork stability

    • Assess checkpoint activation during replication stress

  • Mitochondrial DNA maintenance:

    • Measure mitochondrial DNA integrity and copy number

    • Assess petite formation frequency

    • Analyze mitochondrial function in mutants

    • Test localization to mitochondria during oxidative stress

What collaborative research approaches would most effectively advance understanding of YGL072C function?

Interdisciplinary collaboration strategies include:

  • Multi-organism comparative studies:

    • Partner with labs studying model organisms with YGL072C orthologs

    • Compare phenotypes across evolutionary diverse species

    • Exchange genetic tools and resources

    • Develop standardized assay conditions

  • Technology-driven partnerships:

    • Collaborate with structural biology labs for protein characterization

    • Partner with proteomics facilities for comprehensive PTM analysis

    • Work with computational biology groups for modeling and prediction

    • Engage with synthetic biology teams for designer functional assays

  • Disease-relevance exploration:

    • Collaborate with medical researchers studying related human proteins

    • Investigate potential disease models related to YGL072C function

    • Partner with drug discovery teams if therapeutic relevance emerges

    • Work with biomarker researchers if diagnostic applications arise

  • Data integration initiatives:

    • Contribute to community databases and resources

    • Participate in functional annotation projects

    • Engage in collaborative network mapping efforts

    • Partner in systems biology modeling consortia

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.