Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL074C (YGL074C)

Shipped with Ice Packs
In Stock

Description

Gene Context and Classification

YGL074C is located on Chromosome VII (coordinates 368,596–368,922) of Saccharomyces cerevisiae strain S288c . Key features include:

PropertyValue
DNA Length325 bp
Protein Length109 amino acids
Gene ClassificationDubious ORF
Overlapping Gene5' end of essential HSF1

This ORF is unlikely to encode a functional protein due to its overlap with HSF1, which encodes a heat shock transcription factor critical for stress response .

Recombinant Protein Production

Despite its dubious status, recombinant YGL074C is commercially available for research. Key production details include:

Expression Systems

  • Hosts: E. coli, yeast (S. cerevisiae), baculovirus, and mammalian cells .

  • Tags: N-terminal and/or C-terminal His-tags for purification .

  • Purity: ≥85% as determined by SDS-PAGE .

Physical Properties

ParameterSpecification
Molecular Weight~11.5 kDa
Isoelectric Point (pI)Not explicitly reported
Storage-20°C (lyophilized or liquid)
StabilityAvoid repeated freeze-thaw cycles

Research Applications

  • Antibody Production: Rabbit polyclonal antibodies against YGL074C are available for ELISA and Western blot .

  • Structural Studies: 3D structural models (e.g., ModBase) are accessible for computational analysis .

  • Functional Screening: Used in studies exploring periplasmic protein expression optimization in E. coli .

Controversies and Limitations

  • Dubious ORF Status: YGL074C’s overlap with HSF1 raises questions about its biological relevance .

  • Lack of Functional Data: No direct experimental evidence supports enzymatic or structural roles for YGL074C .

  • Commercial Availability: Vendors like MyBioSource and Creative BioMart market recombinant YGL074C for research, but its utility remains speculative .

Future Research Directions

  • Functional Characterization: Determine if YGL074C has latent roles under specific stress conditions.

  • Interaction Studies: Explore potential binding partners using yeast two-hybrid or co-IP assays .

  • Structural Resolution: Solve crystal/NMR structures to assess folding and domain architecture.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
YGL074C; Putative uncharacterized protein YGL074C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL074C
Target Protein Sequence
MAVEDVVLASVRSVVKISFGCKIFSMSSSFKLGKGSIRGASLTFDSLVVPVFAALFMAPT IQLSFCLFCFLSLPALFVKHTSNSLPLSTGTVLLFGICCQVAKSLLKI
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of YGL074C in Saccharomyces cerevisiae?

YGL074C is classified as a dubious open reading frame in the Saccharomyces cerevisiae genome. It is considered unlikely to encode a functional protein based on current genomic analyses. Significantly, it overlaps with the 5' end of the essential HSF1 gene, making its study particularly challenging . This genomic arrangement requires careful experimental design when targeting YGL074C to avoid inadvertently affecting HSF1 expression. Researchers should employ techniques that can distinguish between effects caused by YGL074C manipulation versus those resulting from altered HSF1 function. When designing knockout or modification experiments, it's advisable to implement precise genomic editing techniques like CRISPR-Cas9 with carefully designed guide RNAs that minimize disruption to HSF1.

How can I determine if YGL074C produces a functional protein despite being classified as dubious?

To determine if YGL074C produces a functional protein despite its dubious classification, implement a multi-faceted experimental approach. Begin with transcriptome analysis using RNA-Seq to verify if the ORF is transcribed under various conditions. Follow with ribosome profiling to determine if the transcript is actually translated. Express the putative protein with epitope tags (N and C-terminal variants to account for potential processing) and perform western blotting to detect expression. Mass spectrometry can validate protein existence and identify potential post-translational modifications. Finally, create precise deletion mutants using CRISPR-Cas9 and assess phenotypic changes under various stress conditions, particularly those affecting HSF1 function . A comprehensive analysis would involve comparing results across multiple yeast strains beyond the reference S288C to account for strain-specific variations in non-essential genes.

What expression systems are most suitable for recombinant production of YGL074C?

For recombinant production of the putative YGL074C protein, consider both homologous and heterologous expression systems with specific optimizations. In homologous S. cerevisiae expression, utilize strong constitutive promoters like TEF2 (as demonstrated in other yeast protein studies) rather than inducible systems to maximize protein yield . Design constructs with codon optimization and include purification tags that minimally impact protein folding. For potentially better yields, heterologous expression in Pichia pastoris might provide advantages for a yeast-derived protein. In either system, optimize growth conditions by testing various media compositions and induction protocols. When purifying, implement affinity chromatography followed by size exclusion to ensure protein integrity. Given YGL074C's dubious nature, always validate that your purified product matches the expected molecular weight and perform mass spectrometry analysis to confirm identity.

How does the overlap with HSF1 complicate functional studies of YGL074C?

The overlap between YGL074C and the essential HSF1 gene creates significant experimental challenges. HSF1 encodes Heat Shock Factor 1, a critical transcription factor controlling cellular stress responses. When designing knockout constructs or CRISPR-Cas9 guide RNAs targeting YGL074C, researchers must ensure these do not disrupt HSF1 expression or function . One methodological approach involves creating precise mutations within YGL074C while maintaining HSF1 sequence integrity. Another strategy employs RNA interference specifically targeting YGL074C transcripts if they exist. Researchers should always include controls measuring HSF1 expression and activity in all experiments targeting YGL074C. Complementation studies using plasmid-expressed HSF1 can help distinguish phenotypes resulting from HSF1 disruption versus genuine YGL074C effects. Additionally, conditional HSF1 mutants can serve as important controls when interpreting YGL074C manipulation results.

What comparative genomics approaches can reveal potential functions of YGL074C homologs across fungal species?

To investigate potential functions of YGL074C homologs across fungal species, implement a comprehensive comparative genomics workflow. Begin by performing sensitive sequence similarity searches using PSI-BLAST and HMM-based methods like HMMER against fungal genome databases, as conventional BLAST searches may miss distant homologs of dubious ORFs. Analyze synteny conservation patterns, as conservation of genomic context across species can indicate functional importance despite sequence divergence. Employ phylostratigraphy to determine the evolutionary age of the sequence and identify potential horizontal gene transfer events. For detected homologs, analyze selection pressures (dN/dS ratios) to identify conserved functional domains. Integrate this data with transcriptomic datasets from multiple species to identify correlated expression patterns. This comprehensive approach can reveal whether YGL074C represents a species-specific adaptation or preserves ancestral function, potentially uncovering roles not apparent in S. cerevisiae alone . Construct a phylogenetic tree of identified homologs and map this against species phenotypes to identify potential functional associations.

How can proteomics approaches be optimized to detect and characterize low-abundance proteins like YGL074C?

Optimizing proteomics approaches for low-abundance proteins like YGL074C requires specialized technical considerations. Implement selective reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry techniques that offer significantly higher sensitivity than conventional shotgun proteomics. Utilize protein fractionation methods like high-pH reversed-phase chromatography prior to LC-MS/MS to reduce sample complexity. Apply targeted enrichment strategies such as expressing YGL074C with split-tag systems that permit tandem affinity purification. Consider proximity labeling methods (BioID or APEX) to identify interaction partners even if YGL074C is transiently expressed. For data analysis, implement advanced computational workflows like Bayesian inference models that can distinguish true signals from noise in low-abundance datasets. To maximize detection probability, analyze samples from cells under various stress conditions, as many dubious ORFs are expressed only under specific environmental challenges . This comprehensive approach maximizes the probability of detecting and characterizing this putative protein if it is indeed expressed.

What metabolic pathways might be affected by YGL074C based on its genetic interactions?

While direct evidence for YGL074C metabolic impacts is limited due to its dubious classification, methodological approaches can reveal potential pathway associations. First, perform synthetic genetic array (SGA) analysis using a precisely engineered YGL074C mutant against the yeast deletion collection to identify genetic interactions. For discovered interactions, construct a genetic interaction network and analyze pathway enrichment to identify metabolic processes potentially linked to YGL074C. Focus particularly on genes involved in carbohydrate storage metabolism, as other uncharacterized yeast ORFs like YER067W have shown impacts on glycogen and trehalose accumulation . Complement genetic studies with metabolomics profiling of YGL074C mutants under various growth conditions, using techniques like LC-MS and GC-MS to detect changes in metabolite levels. Measure reserve carbohydrate content specifically, as changes in glycogen and trehalose levels can indicate alterations in energy metabolism, as observed with other putative yeast proteins . This integrated approach can reveal metabolic functions even for proteins with limited prior characterization.

How can we distinguish between direct and indirect effects when studying the impact of YGL074C manipulation?

Distinguishing between direct and indirect effects in YGL074C studies requires rigorous experimental design and controls. Implement an anchor-away system or a degron tag approach for rapid protein depletion, allowing temporal analysis of primary versus secondary effects. Compare rapid depletion phenotypes with those from conventional knockout studies to identify immediate versus adaptive responses. Utilize an auxin-inducible degron system for conditional and reversible protein depletion, enabling precise temporal control. Perform time-course RNA-Seq and proteomics after YGL074C depletion to distinguish primary transcriptional and translational responses from downstream effects. Implement metabolic flux analysis using stable isotope-labeled substrates to track metabolic changes in real-time after YGL074C manipulation. For proteins identified in interaction studies, validate direct physical interactions using techniques with increasing stringency: co-immunoprecipitation, proximity ligation assays, and ultimately FRET or BRET to confirm direct in vivo interactions. This systematic approach separates causality from correlation in functional studies of poorly characterized proteins .

What are the optimal conditions for expressing recombinant YGL074C in Saccharomyces cerevisiae?

For optimal expression of recombinant YGL074C in S. cerevisiae, implement a systematic optimization protocol. Selection of expression vector and promoter system is crucial; utilize a high-copy 2μ expression plasmid with the constitutive TEF2 promoter, which has been successfully employed for expressing other yeast proteins . Design the construct with codon optimization specific to highly expressed S. cerevisiae genes and include a C-terminal purification tag (6xHis or FLAG) separated by a flexible linker to minimize interference with protein folding. For culture conditions, test a matrix of parameters: media composition (YPD, synthetic defined media with various carbon sources), temperature (20°C, 25°C, 30°C), and growth phase for harvesting (log phase versus stationary phase). Monitor expression using western blotting with antibodies against the purification tag and validate protein identity using mass spectrometry. If expression levels remain low, consider alternative approaches such as genomic integration under the control of the strong GAL1 promoter for inducible expression. The table below summarizes the recommended optimization parameters:

ParameterOptions to TestMonitoring Method
VectorHigh-copy 2μ, integrativeWestern blot
PromoterTEF2, GAL1, ADH1RT-qPCR, Western blot
Growth MediaYPD, SD-URA, YPGalOD600, Growth curve
Temperature20°C, 25°C, 30°CProtein yield, Western blot
Harvest TimeOD600 0.8, 1.5, 2.0, stationaryProtein yield, Western blot
TagsC-term vs. N-term, tag typePurification yield, Activity

What purification strategies are most effective for isolating YGL074C while preserving its structural integrity?

To effectively purify YGL074C while preserving its structural integrity, implement a multi-step purification strategy with condition optimization at each stage. Begin with affinity chromatography using either immobilized metal affinity chromatography (IMAC) for His-tagged constructs or anti-FLAG resin for FLAG-tagged versions. Optimize lysis buffers by testing different components: various detergents (Triton X-100, CHAPS, digitonin) at multiple concentrations, salt concentrations (150-500 mM NaCl), pH ranges (6.5-8.0), and stabilizing agents (5-10% glycerol, 1-5 mM DTT). Following initial capture, implement a size exclusion chromatography step to remove aggregates and contaminants while simultaneously providing information about the oligomeric state of YGL074C. Throughout purification, monitor protein quality using dynamic light scattering to assess homogeneity and circular dichroism to evaluate secondary structure. For functional studies, immediately assess activity after each purification step to identify conditions that preserve native structure. If the protein proves unstable, consider purifying with stabilizing binding partners identified through proteomics studies or utilizing nanobodies that can lock the protein in specific conformations. This systematic approach maximizes the likelihood of obtaining functional protein for subsequent structural and biochemical analyses.

What imaging techniques can effectively visualize subcellular localization of YGL074C?

For effective visualization of YGL074C subcellular localization, implement complementary imaging approaches that balance resolution, sensitivity, and functional impact. Generate endogenously tagged YGL074C constructs using CRISPR-Cas9 to insert fluorescent proteins (mNeonGreen or mScarlet) at either terminus, complemented by episomal expression of tagged constructs as validation. Perform live-cell confocal microscopy under various growth conditions and stress treatments, particularly focusing on conditions that activate HSF1, given the genomic overlap . Implement super-resolution techniques (STED, PALM, or STORM) for precise localization relative to organelle markers. To address potential low expression, utilize signal amplification methods such as split-GFP complementation systems or HaloTag labeling with bright synthetic fluorophores. Complement fluorescence approaches with immunogold electron microscopy using anti-tag antibodies for ultrastructural localization. Critically, perform colocalization studies with markers for specific compartments (nucleus, mitochondria, vacuole, ER) using quantitative colocalization analysis. Time-lapse imaging during stress responses or cell cycle progression can reveal dynamic localization patterns that static imaging might miss. This comprehensive imaging strategy can resolve the subcellular distribution of even low-abundance proteins like YGL074C.

How can researchers design effective CRISPR-Cas9 strategies for precise manipulation of YGL074C without affecting HSF1?

Designing effective CRISPR-Cas9 strategies for YGL074C requires exceptional precision due to its overlap with HSF1. First, conduct thorough bioinformatic analysis to map the exact overlap region and identify potential guide RNA (gRNA) target sites specific to YGL074C. Use specialized algorithms that account for off-target effects, prioritizing gRNAs with minimal homology to other genomic regions, especially HSF1. For knock-in modifications, design homology-directed repair (HDR) templates with silent mutations in the PAM sites to prevent re-cutting while preserving HSF1 coding sequence. Before implementation, validate all gRNAs using in vitro Cas9 cleavage assays with synthetic DNA templates containing the target regions. After modification, comprehensively validate the engineered strains by sequencing both YGL074C and HSF1, and by assessing HSF1 expression and function through heat shock response assays. Consider base editing or prime editing technologies as alternatives to standard CRISPR-Cas9 when introducing point mutations, as these approaches can reduce the risk of double-strand breaks that might affect HSF1. The table below summarizes key considerations for CRISPR-Cas9 design in this context:

Design ConsiderationImplementation StrategyValidation Method
gRNA SelectionTarget YGL074C-specific regions, avoid HSF1In silico off-target prediction
HDR TemplateInclude silent mutations in overlap regionSanger sequencing
Cas9 VariantConsider high-fidelity Cas9 variants with reduced off-target effectsWhole genome sequencing
Editing StrategyBase editing for point mutations to avoid DSBsTarget site sequencing
HSF1 Function CheckN/AHeat shock response assay
Screening MethodTwo-step selection to verify correct editingPCR, restriction digest, sequencing

How should researchers approach differential gene expression analysis when studying YGL074C function?

When conducting differential gene expression analysis to study YGL074C function, implement a comprehensive analytical workflow that accounts for its dubious ORF status and potential genetic interactions. Design experiments with appropriate biological replicates (minimum n=3, preferably n=5) and include multiple control conditions: wild-type, HSF1 mutants, and strains with mutations in adjacent non-overlapping regions. For RNA-Seq, achieve minimum sequencing depth of 20 million reads per sample and implement stranded library preparation to distinguish antisense transcription. During bioinformatic analysis, use specialized tools like DESeq2 or edgeR with multiple testing correction (FDR <0.05) and employ variance stabilizing transformations to handle low-count transcripts. Critically, perform careful quality control including batch effect correction and removal of unwanted variation (RUVSeq). For identifying biological significance, conduct pathway enrichment analysis using multiple databases (GO, KEGG, Reactome) and implement gene set enrichment analysis (GSEA) to detect subtle but coordinated expression changes. Compare your results with publicly available datasets from HSF1 studies to distinguish YGL074C-specific effects from HSF1-mediated responses. This approach maximizes the probability of detecting genuine transcriptional impacts of this putative protein while minimizing false discoveries.

How can researchers effectively integrate multi-omics data to understand YGL074C function?

To effectively integrate multi-omics data for understanding YGL074C function, implement a systematic data integration workflow that leverages complementary information from diverse molecular levels. Begin by generating matched samples for transcriptomics (RNA-Seq), proteomics (LC-MS/MS), metabolomics (GC-MS and LC-MS), and potentially epigenomics (ChIP-Seq for histone modifications if nuclear localization is suspected). Normalize and process each dataset independently using platform-specific best practices before integration. For data integration, implement both unsupervised and supervised fusion approaches: weighted similarity network fusion (SNF) to identify patterns across data types without prior knowledge, and multi-omics factor analysis (MOFA) to extract common factors explaining variation across datasets. Apply pathway-level integration using methods like iPEAP or Pathifier that aggregate signals to biological pathways rather than individual molecules. Implement correlation network analysis across omics layers to identify molecules with coordinated responses that may indicate functional relationships. Specifically search for discordance between transcriptomics and proteomics data, as post-transcriptional regulation may provide clues about YGL074C function. Visualize integrated results using dimension reduction techniques like UMAP colored by condition and omics type. This comprehensive integration approach can reveal functional signatures that might be missed in single-omics analyses, particularly valuable for poorly characterized proteins.

What computational approaches can predict potential functions and interactions of YGL074C?

For computational prediction of YGL074C functions and interactions, implement an ensemble of complementary bioinformatic approaches that leverage different types of biological information. Begin with advanced sequence-based function prediction using deep learning algorithms like DeepFRI that outperform traditional homology-based methods for challenging targets like dubious ORFs. Apply structure prediction using AlphaFold2 or RoseTTAFold to generate structural models, followed by structural similarity searches against the PDB to identify potential functional homologs not detectable by sequence alone. For interaction prediction, implement integrated methods that combine sequence co-evolution analysis, structural interface prediction, and literature-derived interaction networks. Use gene neighborhood techniques to analyze conserved genomic context across species, as genomic proximity often implies functional relationships. Apply advanced co-expression meta-analysis across thousands of public transcriptomics datasets to identify consistent co-expression partners across diverse conditions. For potential regulatory roles, implement motif analysis to detect DNA or RNA binding motifs. Integrate predictions using ensemble learning approaches that combine scores from multiple methods, weighting each based on performance metrics for similar proteins. All predictions should be assigned confidence scores and clearly presented as hypotheses requiring experimental validation. This comprehensive computational approach generates testable hypotheses about functions and interactions for this challenging target.

How might high-throughput CRISPR screens be designed to investigate genetic interactions of YGL074C?

To investigate genetic interactions of YGL074C using high-throughput CRISPR screens, design a customized experimental framework that addresses the gene's dubious nature and HSF1 overlap. Implement a CRISPR interference (CRISPRi) approach using catalytically dead Cas9 (dCas9) rather than nuclease-active Cas9 to repress YGL074C expression without inducing double-strand breaks that might affect HSF1 . Design a genome-wide gRNA library targeting all yeast ORFs, with 4-6 guides per gene to ensure robust coverage. Additionally, include a focused sublibrary with higher coverage of genes involved in stress response pathways to detect subtle genetic interactions. Perform screens under multiple stress conditions (heat shock, oxidative stress, nutrient limitation) to identify condition-specific interactions. For analysis, implement specialized computational pipelines like BAGEL or MAGeCK that account for variable guide efficiency and false discovery rates. Design validation experiments for top hits using traditional genetic approaches like tetrad analysis with double mutants. This approach can reveal genetic interaction networks while minimizing confounding effects from HSF1 disruption, providing insights into the biological context of this poorly characterized genomic region.

What potential roles might YGL074C play in stress response pathways given its genomic proximity to HSF1?

Given YGL074C's genomic overlap with HSF1, a master regulator of stress responses, investigating its potential role in stress response pathways requires specialized experimental approaches. Design comprehensive stress response profiling experiments comparing wild-type, YGL074C mutants (with intact HSF1), and strains with HSF1 mutations. Test a panel of stressors including heat shock, oxidative stress, osmotic stress, and nutrient limitation, monitoring both immediate and adaptive responses. Implement time-course transcriptomics and proteomics after stress induction to identify differential temporal patterns between wild-type and mutant strains. Specifically investigate whether YGL074C modulates HSF1 activity through techniques like ChIP-seq of HSF1 binding sites in wild-type versus YGL074C mutant backgrounds. Examine post-translational modifications of HSF1 under stress conditions in both genetic backgrounds to identify potential regulatory effects. Investigate potential antisense regulation mechanisms, as the overlapping arrangement might enable YGL074C transcription to influence HSF1 expression. Study the conservation of this genomic arrangement across yeast species to determine if the overlap with HSF1 is evolutionarily conserved, suggesting functional importance beyond S. cerevisiae. This multifaceted approach can reveal whether YGL074C has evolved to fine-tune stress responses in coordination with HSF1.

How can single-cell approaches advance our understanding of YGL074C expression heterogeneity?

Single-cell approaches offer powerful tools for understanding expression heterogeneity of challenging targets like YGL074C. Implement single-cell RNA-sequencing (scRNA-seq) using optimized protocols for yeast, such as Drop-seq or inDrop platforms with modified cell wall digestion procedures. To address potential low expression concerns, incorporate unique molecular identifiers (UMIs) and implement computational approaches specifically designed for detecting low-abundance transcripts. Complement scRNA-seq with single-cell protein detection methods like mass cytometry (CyTOF) or microfluidic antibody capture against epitope-tagged YGL074C. To investigate expression dynamics, implement single-molecule RNA FISH (smFISH) with signal amplification to visualize individual YGL074C transcripts within single cells under various conditions. Develop dual-color smFISH probes targeting both YGL074C and HSF1 to examine their co-expression patterns at the single-cell level. For function assessment, combine single-cell transcriptomics with CRISPR perturbation (CRISP-seq) to correlate YGL074C disruption with transcriptome-wide effects in individual cells. Apply advanced computational methods like RNA velocity or pseudotime analysis to reconstruct expression dynamics during stress responses or cell cycle progression. This comprehensive single-cell approach can reveal cell-to-cell variability in YGL074C expression and function that population-level studies would miss.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.