Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YGL088W (YGL088W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YGL088W; Uncharacterized protein YGL088W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL088W
Target Protein Sequence
MHEVTRTYYFFLFFFLSYKRQINAAFIALFDFPLLFIYFPFLILVLFYNSNANLTAIRNT YSISSRLNPSGAFLTHEECGLVLQYIYYWLGLENKFIDLGCNSLSVVCFLADLRVYLRVP G
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGL088W and what do we currently know about this protein?

YGL088W is a protein-coding gene in Saccharomyces cerevisiae S288C classified as a hypothetical protein. According to genomic databases, it has the Entrez Gene ID 852792 . The protein is considered "putative uncharacterized" because its existence has been predicted through computational analysis of the yeast genome, but its function has not been experimentally verified or extensively studied. The gene is located on chromosome VII of S. cerevisiae, identified during the systematic sequencing of this chromosome .

What standard methodologies are used for expression and initial characterization of YGL088W?

Initial characterization of YGL088W typically begins with recombinant expression in yeast systems. The methodology involves:

  • Cloning and vector construction: The YGL088W gene is PCR-amplified from genomic DNA using specific primers that contain appropriate restriction sites. The amplified fragment is then cloned into a suitable expression vector containing selection markers.

  • Transformation into S. cerevisiae: Several approaches can be used, including:

    • Lithium acetate/PEG transformation

    • Electroporation

    • Spheroplast transformation

  • Expression verification: Western blotting with epitope tags (commonly HA, FLAG, or MYC tags fused to the protein) or antibodies raised against synthetic peptides derived from the predicted protein sequence.

  • Subcellular localization: Tagging YGL088W with GFP or other fluorescent reporters to determine its cellular localization using fluorescence microscopy.

  • Growth phenotype analysis: Creating deletion strains (ΔyglL088W) and testing their growth under various conditions (temperature, carbon sources, stress) compared to wild-type strains .

For verification of successful transformation and expression, researchers typically use a combination of drug resistance markers (such as hygromycin or G418) similar to those used in synthetic recombinant population studies .

How can I design appropriate controls for YGL088W functional studies?

Designing appropriate controls is critical for studying uncharacterized proteins like YGL088W. Recommended controls include:

Experimental controls:

  • Wild-type S. cerevisiae S288C strains cultured under identical conditions

  • Empty vector transformants to control for vector effects

  • Deletion mutants (ΔyglL088W) to establish loss-of-function phenotypes

  • Complementation with the wild-type gene to confirm specificity of observed phenotypes

Technical controls:

  • Mating type controls when performing genetic crosses

  • Drug resistance markers (such as hygromycin or G418) to verify successful transformations

  • Cell density normalization across experiments

  • Verification of growth conditions consistency

Control table for YGL088W expression studies:

Control TypePurposeImplementation
Wild-type strainBaseline comparisonS288C strain grown in parallel
Empty vectorControl for vector effectsSame vector without YGL088W insert
Deletion mutantLoss-of-function referenceΔYGL088W strain
Known yeast proteinPositive controlWell-characterized protein with similar properties
Expression timing controlsAccount for cell cycle effectsSamples taken at multiple time points

What are the basic approaches for determining if YGL088W is expressed under normal conditions?

To determine if YGL088W is naturally expressed in S. cerevisiae, researchers can employ several complementary approaches:

  • RT-PCR analysis: Extract total RNA from yeast cells grown under standard conditions, synthesize cDNA, and perform PCR with YGL088W-specific primers to detect mRNA expression.

  • RNA-Seq analysis: Perform transcriptome analysis to quantify YGL088W expression levels across different growth conditions and developmental stages.

  • Northern blotting: Use labeled probes specific to YGL088W to detect and quantify mRNA transcripts.

  • Proteomics approach: Use mass spectrometry-based proteomics to identify the presence of YGL088W peptides in protein extracts from yeast cells.

  • Epitope tagging at the genomic locus: Integrate an epitope tag at the C-terminus of the endogenous YGL088W gene, preserving its natural promoter, to detect native expression levels using Western blotting.

For all these methods, it's essential to include positive controls (genes known to be expressed under similar conditions) and negative controls (regions of the genome not expected to be transcribed) .

What are optimal strategies for determining protein-protein interactions of YGL088W?

Determining protein-protein interactions for uncharacterized proteins like YGL088W requires sophisticated approaches to generate reliable data. Consider these methodological strategies:

  • Yeast two-hybrid (Y2H) screening:

    • Create a bait construct by fusing YGL088W to a DNA-binding domain

    • Screen against a prey library of S. cerevisiae proteins fused to an activation domain

    • Confirm positive interactions through reciprocal Y2H and secondary assays

    • Control for autoactivation by testing the bait construct with empty prey vectors

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Generate strains expressing epitope-tagged YGL088W (e.g., TAP-tag, FLAG-tag)

    • Purify YGL088W complexes under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Implement SILAC or TMT labeling for quantitative analysis

    • Filter against common contaminant databases to reduce false positives

  • Proximity-based labeling techniques:

    • Fuse YGL088W to enzymes like BioID or APEX2

    • These enzymes biotinylate proximal proteins when activated

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures both stable and transient interactions

  • Co-immunoprecipitation validation:

    • Verify key interactions identified in high-throughput screens

    • Test interactions under various cellular conditions and stresses

When analyzing interaction data, implementation of proper statistical methods is crucial to distinguish true interactions from background noise. For each identified interaction, calculate enrichment scores and confidence values based on peptide counts and uniqueness .

How can synthetic recombinant population approaches be applied to study YGL088W function?

Synthetic recombinant population approaches offer powerful strategies for studying uncharacterized genes like YGL088W through genetic interactions. These methodologies leverage natural variation and recombination to reveal functional insights:

  • Construction of diverse genetic backgrounds:

    • Create synthetic recombinant populations using either the "K-method" (multi-parent cross followed by random mating) or "S-method" (pairwise crosses with marker selection) as described in experimental protocols

    • Incorporate YGL088W variants from diverse yeast strains beyond the reference S288C

    • Conduct multiple cycles of outcrossing (at least 12 cycles) to increase recombination and genetic diversity

  • Quantitative trait locus (QTL) mapping:

    • Phenotype the recombinant population for traits potentially related to YGL088W function

    • Genotype individuals using genome sequencing or SNP arrays

    • Perform QTL analysis to identify genomic regions associated with phenotypic variation

    • Look for QTLs that co-localize with YGL088W or interact epistatically with it

  • Experimental evolution approaches:

    • Subject the synthetic recombinant population to selection conditions hypothesized to involve YGL088W

    • Sequence populations at multiple timepoints (e.g., cycle 0, cycle 6, cycle 12) as done in evolution experiments

    • Track allele frequency changes at YGL088W and interacting loci

    • Identify adaptive trajectories and genetic interactions

  • Analysis framework:

    • Implement appropriate bioinformatic pipelines for SNP identification

    • Calculate founder haplotype contributions to recombinant populations

    • Use statistical models to account for population structure and linkage disequilibrium

The outcrossing cycles should include proper diploid selection using antibiotic resistance markers (hygromycin/G418) and appropriate sporulation techniques to ensure genetic recombination, following established protocols for synthetic population construction .

What computational approaches can predict potential functions of YGL088W?

For uncharacterized proteins like YGL088W, computational approaches provide critical initial insights that guide experimental design. Implement these advanced computational strategies:

  • Sequence-based predictions:

    • Profile-based methods (HMMER, PSI-BLAST) to detect remote homologies

    • Domain prediction tools (InterPro, SMART, Pfam) to identify functional modules

    • Transmembrane topology predictors (TMHMM, Phobius) to assess membrane association

    • Signal peptide predictors (SignalP) to determine subcellular targeting

    • Structure prediction tools (AlphaFold2, RoseTTAFold) to generate structural models

  • Integrative genomic analysis:

    • Co-expression network analysis to identify genes with correlated expression patterns

    • Phylogenetic profiling to find genes with similar evolutionary patterns

    • Synthetic genetic array (SGA) data analysis to identify genetic interactions

    • Chromatin accessibility and binding site predictions to understand regulation

  • Structural bioinformatics:

    • Structural alignment with characterized proteins

    • Ligand-binding site prediction

    • Molecular docking with potential interaction partners

    • Molecular dynamics simulations to assess conformational flexibility

  • Machine learning approaches:

    • Implement supervised learning algorithms using known protein features

    • Apply unsupervised learning to cluster YGL088W with functionally characterized proteins

    • Use feature importance analysis to identify key predictive features

These computational approaches should be systematically integrated and cross-validated to develop a consensus functional hypothesis that can be experimentally tested. The confidence levels of predictions should be clearly indicated, and multiple alternative hypotheses should be considered when designing validation experiments.

What are effective strategies for resolving contradictory experimental data about YGL088W?

When facing contradictory experimental results about YGL088W function, a systematic approach to resolve discrepancies is essential:

  • Methodological reconciliation:

    • Create a comprehensive matrix of experimental conditions across contradictory studies

    • Systematically vary key parameters (strain backgrounds, media composition, temperature)

    • Implement standardized protocols across laboratory members and collaborators

    • Utilize thematic analysis frameworks to organize qualitative data and identify patterns

  • Statistical reanalysis:

    • Perform meta-analysis of available data when sufficient studies exist

    • Implement Bayesian statistical approaches to update confidence in hypotheses given new data

    • Use power analysis to determine if sample sizes were adequate

    • Employ more sophisticated statistical models that can account for batch effects and other sources of variation

  • Orthogonal validation approaches:

    • Design experiments using fundamentally different methodologies to test the same hypothesis

    • Implement CRISPR-based approaches alongside traditional gene deletion methods

    • Compare results from both in vivo and in vitro experimental systems

    • Validate findings in different strain backgrounds

  • Data integration framework:

    • Develop a weighted evidence scheme based on methodological rigor

    • Create visualization tools to represent the strength of evidence for competing hypotheses

    • Implement formal contradiction resolution protocols from thematic analysis methods

Contradiction resolution matrix:

Contradictory FindingPossible ExplanationsExperimental Reconciliation Approach
Differential localizationCell-cycle dependent localizationTime-course microscopy with cell cycle markers
Inconsistent phenotypesStrain background effectsTest in isogenic panel of strain backgrounds
Variable interaction partnersCondition-dependent interactionsAP-MS under multiple environmental conditions
Discrepant expression dataTechnical artifacts in RNA isolationCompare multiple RNA extraction methods
Different functional predictionsAlgorithm-specific biasesConsensus approach across multiple prediction tools

How can I design robust experiments to determine if YGL088W is involved in specific cellular pathways?

Designing robust experiments to determine YGL088W's involvement in specific cellular pathways requires systematic approaches that minimize bias and maximize detection power:

  • Hypothesis-neutral screening approaches:

    • Conduct genome-wide synthetic genetic interaction screens with YGL088W deletion

    • Perform chemical genomic profiling to identify conditions where YGL088W is essential

    • Use proteome-wide protein-protein interaction mapping

    • Implement unbiased metabolomic profiling comparing wild-type and YGL088W mutants

  • Targeted pathway analysis:

    • Select pathways for investigation based on computational predictions

    • Design genetic epistasis experiments placing YGL088W in relation to known pathway components

    • Use pathway-specific reporter systems to detect functional perturbations

    • Implement time-resolved analyses to determine execution point in sequential pathways

  • Experimental design considerations:

    • Utilize factorial experimental designs to test multiple hypotheses simultaneously

    • Implement appropriate blocking to control for batch effects

    • Determine adequate sample sizes through power analysis

    • Include both positive and negative controls for each assay

    • Blind researchers to sample identity when possible

  • Validation framework:

    • Require independent confirmation of key findings using alternative methods

    • Test across multiple genetic backgrounds to ensure generalizability

    • Apply increasingly stringent criteria for pathway assignment:

      • Level 1: Statistical association

      • Level 2: Direct physical interaction with pathway components

      • Level 3: Mechanistic understanding of molecular function

Proper experimental design should include randomization of samples, appropriate replication (both biological and technical), and systematic variation of conditions to ensure robust findings that can be confidently interpreted in the context of specific cellular pathways.

What are the optimal sporulation and mating techniques for studying YGL088W in different genetic backgrounds?

Optimizing sporulation and mating techniques is crucial when studying YGL088W across different genetic backgrounds:

  • Enhanced sporulation protocols:

    • Pre-growth in YPD media followed by transfer to sporulation media containing 1% potassium acetate

    • Incubation for 72 hours at 30°C with shaking at 200 rpm to achieve maximum sporulation efficiency

    • Implementation of improved ascus digestion using a combination approach:

      • Treatment with Y-PER yeast protein extraction reagent to eliminate vegetative diploids

      • Enzymatic digestion with 1% zymolyase to weaken ascus walls

      • Mechanical disruption using high-speed shaking with 0.5 mm silica beads

  • Mating type selection strategies:

    • Use of complementary selectable markers (hygromycin/G418 resistance) to isolate desired mating products

    • Implementation of mating-type specific promoters to drive expression of selection markers

    • Recovery of diploids through selection on appropriate media and verification through microscopic examination of cell morphology

  • Background-specific adjustments:

    • Modification of sporulation conditions for poor-sporulating strains:

      • Extended incubation periods

      • Supplementation with amino acids for auxotrophic strains

      • Adjusted nitrogen:carbon ratios in sporulation media

    • Strain-specific mating protocols based on known mating efficiencies

  • Quality control metrics:

    • Sporulation efficiency assessment through microscopic counting

    • Mating efficiency calculation using quantitative plating assays

    • Genetic marker verification through selective growth assays

    • Confirmation of desired genotypes using PCR-based methods

These optimized protocols ensure maximum genetic recombination efficiency while maintaining cell viability, which is essential for studying YGL088W across varied genetic backgrounds.

What genomic sequencing approaches best capture variations in YGL088W across strains?

To effectively capture variations in YGL088W across different yeast strains, consider these advanced genomic sequencing approaches:

  • Targeted sequencing strategies:

    • Amplicon-based deep sequencing of the YGL088W locus and flanking regions

    • Capture-based enrichment using custom probes designed for YGL088W and related genes

    • Long-read sequencing to resolve structural variations and complex rearrangements

    • Implementation of unique molecular identifiers (UMIs) to correct for PCR and sequencing errors

  • Whole-genome sequencing considerations:

    • Population-level sequencing at specific experimental timepoints (e.g., initial, cycle 6, cycle 12) to track evolutionary trajectories

    • Sufficient coverage depth (minimum 30X) to confidently call variants

    • Combination of short-read (Illumina) and long-read (Oxford Nanopore, PacBio) technologies for comprehensive variant detection

    • Inclusion of reference strain controls (S288C) in each sequencing batch

  • Bioinformatic analysis pipeline:

    • Alignment against multiple reference genomes to minimize reference bias

    • Implementation of variant callers optimized for yeast genomics

    • Specialized analysis for copy number variations and structural rearrangements

    • Functional annotation of variants using prediction algorithms

  • Haplotype analysis framework:

    • Phasing of variants to reconstruct complete haplotypes

    • Estimation of relative founder haplotype contributions to synthetic populations

    • Linkage disequilibrium analysis to understand recombination patterns

    • Phylogenetic analysis of YGL088W variants to understand evolutionary relationships

Sequencing approach comparison table:

Sequencing MethodAdvantagesLimitationsBest Application
Short-read WGSHigh accuracy for SNPsLimited for structural variantsPopulation sequencing
Long-read WGSResolves complex regionsHigher error rateStructural variant detection
Amplicon sequencingHigh depth at low costLimited to targeted regionSpecific variant validation
RNA-SeqCaptures expressed variantsMisses non-expressed regionsExpression-coupled variant analysis
Nanopore direct RNADetects RNA modificationsLower throughputEpitranscriptomic analysis

What statistical approaches are most appropriate for analyzing YGL088W functional data?

Selecting appropriate statistical approaches for analyzing YGL088W functional data requires careful consideration of experimental design and data characteristics:

  • Experimental design-based statistical approaches:

    • For multi-factorial experiments: multi-way ANOVA with appropriate post-hoc tests

    • For time-series data: repeated measures ANOVA or mixed-effects models

    • For dose-response relationships: non-linear regression models with parameter estimation

    • For comparing growth curves: area under curve (AUC) analysis or growth rate modeling

  • High-dimensional data analysis:

    • For transcriptomic data: differential expression analysis with multiple testing correction

    • For proteomic data: specialized normalization methods and interaction network analysis

    • For metabolomic data: multivariate approaches like principal component analysis (PCA) and partial least squares discriminant analysis (PLS-DA)

    • For genetic interaction data: E-MAP scoring systems and network analysis

  • Bayesian statistical frameworks:

    • Implementation of Bayesian hierarchical models to integrate prior knowledge

    • Bayesian network analysis to infer causal relationships

    • Bayesian experimental design to optimize follow-up experiments

    • Credible interval estimation for parameters of interest

  • Specialized approaches for genetic studies:

    • QTL mapping statistics for linking genotype to phenotype

    • Methods for detecting selective sweeps in experimental evolution

    • Population genetic statistics for analyzing diversity and divergence

    • Statistical frameworks for epistasis detection

When analyzing contradictory data, thematic analysis approaches can help organize qualitative findings and identify patterns that may explain discrepancies . For all statistical approaches, appropriate sample sizes should be determined through power analysis, and results should be interpreted in the context of both statistical and biological significance.

How can CRISPR-Cas9 technology be optimized for studying YGL088W function?

CRISPR-Cas9 technology offers powerful approaches for studying uncharacterized proteins like YGL088W with unprecedented precision:

  • Optimized CRISPR-Cas9 editing strategies:

    • Design of multiple sgRNAs targeting different regions of YGL088W using yeast-optimized algorithms

    • Implementation of improved Cas9 expression systems with regulated promoters

    • Development of ribonucleoprotein (RNP) delivery methods for transient Cas9 expression

    • Creation of scarless editing protocols to avoid marker effects

  • Advanced functional genomic applications:

    • CRISPRi (interference) for tunable repression of YGL088W expression

    • CRISPRa (activation) to upregulate YGL088W in different conditions

    • Base editing to introduce specific point mutations without double-strand breaks

    • Prime editing for precise sequence replacements

  • High-throughput functional screening:

    • Pooled CRISPR screens using libraries of sgRNAs targeting regions around YGL088W

    • Multiplexed editing to simultaneously modify YGL088W and potential interacting genes

    • CRISPR scanning mutagenesis to identify functional domains within YGL088W

    • Implementation of barcoding strategies for tracking edited cells in competitive assays

  • Technical optimization considerations:

    • Codon optimization of Cas9 for improved expression in S. cerevisiae

    • Engineering of improved guide RNA scaffolds for higher editing efficiency

    • Optimization of homology-directed repair templates for precise modifications

    • Development of methods to limit off-target effects in the yeast genome

This advanced CRISPR toolkit provides researchers with unprecedented control over YGL088W modification, allowing for systematic functional characterization from single nucleotide changes to complete gene deletion and controlled expression.

What are the latest approaches for determining the three-dimensional structure of uncharacterized proteins like YGL088W?

Determining the three-dimensional structure of uncharacterized proteins like YGL088W has become increasingly accessible through recent technological advances:

These complementary approaches provide a comprehensive strategy for elucidating the structure of YGL088W, which can significantly accelerate functional characterization by revealing potential binding sites, catalytic residues, and interaction interfaces.

How can multi-omics approaches be integrated to comprehensively characterize YGL088W function?

Multi-omics integration provides a powerful framework for comprehensive characterization of uncharacterized proteins like YGL088W:

  • Multi-omics data generation strategies:

    • Coordinated experimental design across omics platforms:

      • Transcriptomics (RNA-Seq) to identify co-regulated genes

      • Proteomics to determine protein abundance and post-translational modifications

      • Metabolomics to detect metabolic changes in YGL088W mutants

      • Genomics to identify genetic interactions

    • Temporal sampling to capture dynamic responses

    • Perturbation studies with YGL088W deletion, overexpression, and mutation

  • Computational integration frameworks:

    • Network-based integration approaches:

      • Construction of multi-layered networks incorporating different data types

      • Network propagation algorithms to identify functional modules

      • Differential network analysis to detect condition-specific changes

    • Matrix factorization methods to identify latent patterns across datasets

    • Bayesian integration approaches to leverage prior knowledge

  • Advanced analysis techniques:

    • Single-cell multi-omics to capture cellular heterogeneity

    • Spatial transcriptomics/proteomics to understand subcellular localization

    • Trajectory inference to map temporal processes

    • Causal modeling to infer regulatory relationships

  • Validation and hypothesis generation:

    • Targeted experiments to validate key predictions from integrated analysis

    • Iterative refinement of multi-omics data based on experimental feedback

    • Visualization tools for exploring complex multi-dimensional datasets

    • Development of testable mechanistic models of YGL088W function

Multi-omics integration workflow:

Data LayerKey InformationIntegration Approach
GenomicsSequence variants, CNVsFoundation for all analyses
TranscriptomicsExpression patterns, co-regulationCorrelation networks with YGL088W
ProteomicsProtein abundance, PTMs, interactionsPhysical interaction networks
MetabolomicsMetabolic impacts of YGL088WPathway enrichment analysis
PhenomicsPhenotypic consequencesEnd-point integration for functional validation

What are the current knowledge gaps and promising research directions for YGL088W characterization?

Despite advances in genomics and molecular biology, significant knowledge gaps remain in our understanding of YGL088W, presenting several promising research directions:

  • Current knowledge gaps:

    • Precise molecular function remains unknown despite genomic sequence availability

    • Regulatory mechanisms controlling YGL088W expression are poorly defined

    • Interaction partners and pathway associations lack comprehensive characterization

    • Evolutionary conservation patterns and functional significance across yeast species remain unexplored

    • Potential roles in stress response or specialized metabolic pathways need investigation

  • Promising research directions:

    • Implementation of high-throughput CRISPR screens to identify conditions where YGL088W becomes essential

    • Application of synthetic genetic array (SGA) analysis to map the genetic interaction landscape

    • Exploration of condition-specific expression patterns across diverse environmental stresses

    • Comparative genomics analysis across Saccharomyces species to identify conserved features

    • Investigation of potential moonlighting functions through proteome-wide interaction screening

  • Methodological innovations needed:

    • Development of specific antibodies or improved tagging strategies for native protein detection

    • Creation of reporter systems to monitor YGL088W expression in real-time

    • Implementation of single-cell approaches to capture cell-to-cell variability in YGL088W function

    • Refinement of computational prediction tools specifically for uncharacterized yeast proteins

  • Collaborative research opportunities:

    • Integration with large-scale functional genomics projects

    • Contribution to synthetic biology efforts for minimal yeast genome construction

    • Participation in community-based annotation initiatives for hypothetical proteins

    • Cross-disciplinary approaches combining structural biology, systems biology, and evolutionary analysis

These research directions offer complementary approaches to address the fundamental question of YGL088W function, potentially revealing new insights into yeast biology and providing methodological advances applicable to other uncharacterized proteins.

How does research on YGL088W contribute to broader understanding of uncharacterized proteins in model organisms?

Research on YGL088W contributes significantly to our broader understanding of uncharacterized proteins in model organisms:

  • Methodological advancements:

    • Development of systematic frameworks for prioritizing and characterizing hypothetical proteins

    • Refinement of computational prediction tools through experimental validation

    • Establishment of integrated multi-omics approaches for functional discovery

    • Creation of standardized pipelines for reporting and sharing data on uncharacterized proteins

  • Conceptual contributions:

    • Insights into the "dark proteome" of Saccharomyces cerevisiae despite its status as a well-studied model organism

    • Understanding evolutionary conservation patterns of hypothetical proteins

    • Revealing potential novel biological functions not predicted by established paradigms

    • Elucidating principles of protein function prediction that can be applied across species

  • Systems biology perspective:

    • Integration of uncharacterized proteins into comprehensive cellular networks

    • Understanding robustness and redundancy in biological systems

    • Identification of condition-specific functions that may explain why certain genes appear dispensable

    • Recognition of context-dependent protein functions that vary across conditions

  • Translational implications:

    • Potential discovery of novel enzymatic activities with biotechnological applications

    • Identification of new antifungal targets through characterization of essential functions

    • Contributions to synthetic biology efforts to design minimal genomes

    • Development of improved heterologous expression systems for industrial applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.